DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Carm1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_067506.2 Gene:Carm1 / 59035 MGIID:1913208 Length:608 Species:Mus musculus


Alignment Length:346 Identity:119/346 - (34%)
Similarity:185/346 - (53%) Gaps:33/346 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HTDANQIIKDRRRQEE--HYFKLYGRIEIHEWLLKDSVRIKAYREAI-QHNEFFRHKTVLDVGCG 77
            ||....:..:|..:..  .||:.||.:...:.:::|.||...|:.|| |::..|:.|.|||||||
Mouse   131 HTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCG 195

  Fly    78 MGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVC 142
            .|:||.|||:||::::.||||:|:::.|:.:|:.|.....|.||.||||::.||:   :||||:.
Mouse   196 SGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPE---QVDIIIS 257

  Fly   143 DWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDL--------GFWH--DV 197
            :.||..||:..||||.|.|: |:|..:|:::|....::||..  .|:.|        .||:  ..
Mouse   258 EPMGYMLFNERMLESYLHAK-KYLKPSGNMFPTIGDVHLAPF--TDEQLYMEQFTKANFWYQPSF 319

  Fly   198 HGFDLSAIRRRCESKAVVEHV---TGDQMMSRVCLVKSLDLYTEPRQSAKSRSL------FELKV 253
            ||.||||:|    ..||.|:.   ..|....|:.:.||:. ||.....||...|      |:..:
Mouse   320 HGVDLSALR----GAAVDEYFRQPVVDTFDIRILMAKSVK-YTVNFLEAKEGDLHRIEIPFKFHM 379

  Fly   254 SRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPS 318
            ..:|.||||..:|||.|..|...:..||:|:.|.|||.|.....::||..:||:.:.|...:..:
Mouse   380 LHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIAN 444

  Fly   319 EDSIFDTEFDIFVNFDGREKS 339
            :...:|......|:..|.:.|
Mouse   445 KRQSYDISIVAQVDQTGSKSS 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 38/79 (48%)
Carm1NP_067506.2 CARM1 35..139 CDD:402914 2/7 (29%)
AdoMet_MTases 189..284 CDD:100107 48/98 (49%)
Transactivation domain 500..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.