DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and TRMT9B

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_011542898.1 Gene:TRMT9B / 57604 HGNCID:26725 Length:539 Species:Homo sapiens


Alignment Length:329 Identity:57/329 - (17%)
Similarity:103/329 - (31%) Gaps:124/329 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGK------VEDIE 129
            :.|:|||.|            :.|.|.:..      ..|..:..|.::::.:.:      .:::.
Human   133 IADIGCGTG------------KYLKVNSQV------HTVGCDYCGPLVEIARNRGCEAMVCDNLN 179

  Fly   130 LP------DGIKKVDII-----------VCDWMGSCLFSGNMLESLLFARDK------------- 164
            ||      |.|..:.:|           ....|...|..|..|...::|.::             
Human   180 LPFRDEGFDAIISIGVIHHFSTKQRRIRAIKEMARVLVPGGQLMIYVWAMEQKNRHFEKQDVLVP 244

  Fly   165 WLSA-TGHIYPDTAQLYLAAIKGRDQDLGFWHDVHGF-----DLS---AIRRRCESKAVVEHVTG 220
            |..| ...::.:::|      .||.:..|:....|.:     :.|   ..:.:|.||.  .|..|
Human   245 WNRALCSQLFSESSQ------SGRKRQCGYPERGHPYHPPCSECSCSVCFKEQCGSKR--SHSVG 301

  Fly   221 -DQMMSRVCLV-------KSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRI 277
             :..|:|.|..       :....|:...:|.:|            |      :|.....:||.|.
Human   302 YEPAMARTCFANISKEGEEEYGFYSTLGKSFRS------------W------FFSRSLDESTLRK 348

  Fly   278 SFSTSPSAPWTHWNQTVFYLETPLPVRAGEC-IKGVLTMKPSEDSIFDTEFDIFVNFDGREKSVT 341
            .                  :|...|::..|. ....:|::||..|..|        ||.:|...|
Human   349 Q------------------IERVRPLKNTEVWASSTVTVQPSRHSSLD--------FDHQEPFST 387

  Fly   342 IHQS 345
            ..||
Human   388 KGQS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 15/101 (15%)
TRMT9BXP_011542898.1 AdoMet_MTases 86..>224 CDD:302624 18/108 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.