DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and alkbh8

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_009290865.1 Gene:alkbh8 / 556362 ZFINID:ZDB-GENE-100922-251 Length:666 Species:Danio rerio


Alignment Length:323 Identity:67/323 - (20%)
Similarity:97/323 - (30%) Gaps:112/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNEF------FRHKTVLDVGCGMGV---- 80
            ||.:||.  ||..|            :|||....::|.:.      .:|..|.:.|.|.||    
Zfish     8 RRTKEEK--KLLRR------------QIKASHTLLKHEDITTVSHPTKHLVVSNGGLGNGVSRES 58

  Fly    81 ------------------------LSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVI 121
                                    :|..:.:||......:...|:.  .|.......|..|::|.
Zfish    59 LLEVLKEGGTVESLLTPPSKPYAFVSYSSIEAGQNAYTLLNGRTLQ--CQDQTMTLYFSYVVKVD 121

  Fly   122 QGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLE---SLLFARDKWLSATGHIYPDTAQLYLAA 183
            ..:.....||.|:..::..|            .||   .:|.|.| |   |.|....|||..|..
Zfish   122 CDRSVSCALPPGLSVLEDFV------------SLEEELQILKAVD-W---TPHADDVTAQKALKH 170

  Fly   184 IKGRDQDLGFWHDVHGFD------------LSAIRRRC-------------------ESKAVVEH 217
            .:.:.....|.:|.:..|            ..|:.:||                   ..:.:..|
Zfish   171 RRVKHYGYEFRYDNNNVDKDKPLPGGLPVECDALLQRCLAGGHISVLPDQLTVNQYQSGQGIPPH 235

  Fly   218 VTGDQMMSRVCLVKSLDLYT-------EPRQSA---KSRSLFELK-VSRNGWVHGLV-AYFDV 268
            |..........|..||...|       :.|..|   ..|||..:| .||..|.||:. ..|||
Zfish   236 VDTHSPFEDTILSLSLGAKTVMDFKHPDGRSVAVVLPERSLLVMKGESRYLWTHGITPRKFDV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 17/107 (16%)
alkbh8XP_009290865.1 RRM_ALKBH8 40..119 CDD:240877 13/80 (16%)
2OG-FeII_Oxy 130..300 CDD:304390 42/185 (23%)
Methyltransf_11 409..498 CDD:285453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.