DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and LOC556054

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_003200481.1 Gene:LOC556054 / 556054 -ID:- Length:410 Species:Danio rerio


Alignment Length:310 Identity:136/310 - (43%)
Similarity:207/310 - (66%) Gaps:6/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVL 94
            ::||..|....|||.:|||.||...||.::.||: .|:.|.|||||.|.|:|||||||||:|.|.
Zfish    90 DYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVY 154

  Fly    95 AVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLL 159
            .:|.::|||:::::::.|....||.:.:||||:.|||  :.:||||:.:|||.|||..:||.:::
Zfish   155 GIECSSISEYSEKIIKANHLDSVITIFKGKVEETELP--VDQVDIIISEWMGYCLFYESMLNTVI 217

  Fly   160 FARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGD 221
            :||||||...|.::||.|.||:.||:.|   |..:.:|.:|:|||::.||.....:.:|:.|...
Zfish   218 YARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMKEPLVDIVDSK 282

  Fly   222 QMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAP 286
            |::|..||:|.:|:||...:.....|.|.|::.||.::|.||.||::.|:|..::..|||:|.||
Zfish   283 QVVSNSCLIKEVDIYTVKPEELSFTSSFCLQIQRNDYIHALVTYFNIEFTKCHKKTGFSTAPDAP 347

  Fly   287 WTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGR 336
            :|||.|||||||..|.|:.||.|.|.::|||:|.::.|.:|...::|.|:
Zfish   348 FTHWKQTVFYLEEYLTVKRGEEIVGTVSMKPNEKNVRDLDFTFELDFKGQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 40/79 (51%)
LOC556054XP_003200481.1 AdoMet_MTases 131..231 CDD:100107 51/101 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.