DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and zgc:162780

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001038249.1 Gene:zgc:162780 / 555377 ZFINID:ZDB-GENE-070410-92 Length:274 Species:Danio rerio


Alignment Length:275 Identity:54/275 - (19%)
Similarity:95/275 - (34%) Gaps:86/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EEH---YFKLYGRIEIHEWLLKDSVRIKAYREAIQHNEFFRHKTVLDVGCGMGVLSMFAAKAGSK 91
            :||   |:|.  ||...|.|:...::..      ::||:..:...:|||||.|..::..|...: 
Zfish     9 KEHANSYWKY--RISPSEELIGKVLQFH------RNNEYSSNGLAVDVGCGSGQGTLLLAPHFT- 64

  Fly    92 RVLAVEAATISEFAQQVVQDNEFGRV------IQVIQGKVEDIELPDGIKKVDIIVC----DWMG 146
            ||:..:.:.    ||.     |.||.      :...:...|::...||  .||::..    .|..
Zfish    65 RVVGTDISP----AQL-----EMGRKHVNIPNVSFRESPAEELPFEDG--SVDLVTAMSAFHWFD 118

  Fly   147 SCLF--------------------------SGNMLESLLFARDKWLSA-----TGHIYPDTAQLY 180
            ...|                          .||..|:|....:::.:|     ..|:.|.:.:||
Zfish   119 HSRFLQEADRVLKPHGCLALLNYTLDMELTYGNCSEALNLICNEFYAALHPLRDPHLGPSSFELY 183

  Fly   181 LAAIKGRDQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLD-----LYTEPR 240
            ..........:..|||:...          .|||       .:...:.:|||..     |.|:|.
Zfish   184 KRTYDSLQYPVKEWHDLFWV----------KKAV-------PLSGYIGMVKSFSTFQTLLKTDPE 231

  Fly   241 QSAKSRSLFELKVSR 255
            ::.:.....|.::.|
Zfish   232 EARRLSQGIEDRLKR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 20/89 (22%)
zgc:162780NP_001038249.1 Methyltransf_11 46..138 CDD:285453 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.