DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT6

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:331 Identity:118/331 - (35%)
Similarity:181/331 - (54%) Gaps:22/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKMDGNHTDA--NQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTV 71
            |:.||...:|  .:..:.:|.:::.|::.|..:.:||.::.|.||..|||..|..| ...|.|||
Human    22 EEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTV 86

  Fly    72 LDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKK 136
            ||||.|.|:||:|.|:||::||.||||:.|.:.|::||:.|.....:.|:.|.||.:|||:   :
Human    87 LDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPE---Q 148

  Fly   137 VDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR--DQDLGFWHDV-- 197
            ||.||.:|||..|...:||.|:|.||.|||...|.:.|.:|:|::|.|..:  :..||||..|  
Human   149 VDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQ 213

  Fly   198 -HGFDLSAIR---RRC---ESKAVVEHVTGDQMMSRVCLVKSLDLY---TEPRQSAKSRSLFELK 252
             :|.|:|.:.   .||   .|:.||:.::|:.:::|......|:|.   .|....|.....|...
Human   214 HYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCS 278

  Fly   253 VSRNGWVHGLVAYFDVGF--SKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTM 315
            ...:..:||...:|.|.|  .:|.:.:..||||..|.|||.|.:.||..|:.|.....:.|.:|:
Human   279 CYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITL 343

  Fly   316 KPSEDS 321
            .||.|:
Human   344 LPSRDN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 39/79 (49%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 4/15 (27%)
AdoMet_MTases 67..>200 CDD:418430 62/135 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.