DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT7

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_011521414.1 Gene:PRMT7 / 54496 HGNCID:25557 Length:714 Species:Homo sapiens


Alignment Length:328 Identity:76/328 - (23%)
Similarity:130/328 - (39%) Gaps:61/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QEEHYFKLYGRIEIHEWLLKDSV---------RIKAY---REAIQHNEFFRHKT-VLDVGCGMGV 80
            ::|||       :.|:.:.:.|.         .:|.|   |.|:...:....|. |||:|.|.|:
Human    20 EDEHY-------DYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQKALVLDIGTGTGL 77

  Fly    81 LSMFAAKAGSKRVLAVEA-ATISEFAQQVVQDNEFGRVIQVIQGKVEDIEL-PDGIK--KVDIIV 141
            |||.|..||:....|:|. ..:::.|.::|:.|.|...|:||.....::.: |:|..  :.:|:|
Human    78 LSMMAVTAGADFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGPEGDMPCRANILV 142

  Fly   142 CDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIK-GR------------DQDLGF 193
            .:...:.|.....|.|...|....:.......|..|.:|...:: ||            ...||.
Human   143 TELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFPIHVQTSLGE 207

  Fly   194 WHDVHGFDLSAIRRRCESKAVVEHVTGDQ-------MMSRVCLVKSLDLYTEPRQSAKSRS-LFE 250
            ...|...|:.:    |.....|..:..:|       ::|.|..:.|:|...:...||...| .||
Human   208 QVIVPPVDVES----CPGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQVSSSAACHSRRFE 268

  Fly   251 LKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSP----SAP----W-THWNQTVFYLETPLPVRAG 306
            ...|  |....:::::|:..... .:|..:.:|    |.|    | .||.|.|::|....||..|
Human   269 PLTS--GRAQVVLSWWDIEMDPE-GKIKCTMAPFWAHSDPEEMQWRDHWMQCVYFLPQEEPVVQG 330

  Fly   307 ECI 309
            ..:
Human   331 SAL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 25/84 (30%)
PRMT7XP_011521414.1 AdoMet_MTases 37..>186 CDD:302624 37/148 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.