powered by:
Protein Alignment Art2 and atpsckmt
DIOPT Version :9
Sequence 1: | NP_001285600.1 |
Gene: | Art2 / 33631 |
FlyBaseID: | FBgn0031592 |
Length: | 355 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001278635.1 |
Gene: | atpsckmt / 492519 |
ZFINID: | ZDB-GENE-041114-90 |
Length: | 224 |
Species: | Danio rerio |
Alignment Length: | 33 |
Identity: | 14/33 - (42%) |
Similarity: | 19/33 - (57%) |
Gaps: | 2/33 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 FKLYGRIEIHEWLLKDSVRIKAYREAIQHNEFF 66
||..| .|::.||:..| |.||:||.:.|...|
Zfish 103 FKAVG-FELNPWLVWYS-RYKAWREGVHHTTSF 133
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Art2 | NP_001285600.1 |
AdoMet_MTases |
70..>150 |
CDD:100107 |
|
atpsckmt | NP_001278635.1 |
Methyltransf_18 |
82..>162 |
CDD:289607 |
14/33 (42%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.