DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_012821800.1 Gene:prmt1 / 448086 XenbaseID:XB-GENE-484022 Length:369 Species:Xenopus tropicalis


Alignment Length:311 Identity:137/311 - (44%)
Similarity:211/311 - (67%) Gaps:6/311 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTVLDVGCGMGVLSMFAAKAGSKRV 93
            :::||..|....|||.:|||.||...||.::.|| ..|:.|.|||||.|.|:|.|||||||:|:|
 Frog    48 KDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKV 112

  Fly    94 LAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESL 158
            :.:|.::||::|.::|:.|:...|:.:|:||||::|||  ::|||||:.:|||.|||..:||.::
 Frog   113 IGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTV 175

  Fly   159 LFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTG 220
            ::||||||:..|.|:||.|.||:.||:.|   |..:.:|.:|:|||:|.|:.....:.:|:.|..
 Frog   176 IYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDP 240

  Fly   221 DQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSA 285
            .|:::..||:|.:|:||.........|.|.|:|.||.::|.|||||::.|::..:|..|||||.:
 Frog   241 KQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSPES 305

  Fly   286 PWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGR 336
            |:|||.|||||:|..|.|:.||.|.|.::|||:..:..|.:|.:.::|.|:
 Frog   306 PYTHWKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 41/79 (52%)
prmt1XP_012821800.1 AdoMet_MTases 90..190 CDD:100107 52/101 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.