DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and CG3337

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster


Alignment Length:122 Identity:28/122 - (22%)
Similarity:46/122 - (37%) Gaps:35/122 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IKAYREAIQHNEFFRHKT----VLDVGCGMGVLSMFAAK-AGSKRVLAVEA-------ATISEFA 105
            :.|..|.||:...|..|.    :||:|.|.|.:.:.||: .|:.:...||.       :.::...
  Fly    58 VPATTEQIQNVLSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRLAALR 122

  Fly   106 QQVVQDNEFGR--------------VIQVIQGKVEDI------ELPDGIKKVDIIVC 142
            ..|.:...|.|              ||..::..::|:      |.|...|   ||.|
  Fly   123 HSVSKRTRFFRRDLWKFDIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTK---IIAC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 22/105 (21%)
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 16/88 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.