DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Art6

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster


Alignment Length:339 Identity:145/339 - (42%)
Similarity:216/339 - (63%) Gaps:7/339 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAI-QHNEFFRHKTVLDVGCGMGVL 81
            :|||.:.....::..||:.|.|:|.|..:|:||||::|:|:|| |....|:.|.|||||||.|:|
  Fly     4 NANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGIL 68

  Fly    82 SMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMG 146
            |:|||:||:.:|:|||...|::.|:::::||:...|::|::|.||.:||||||:||||||.:|||
  Fly    69 SLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMG 133

  Fly   147 SCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYL--AAIKGRDQDLGFWHDVHGFDLSAIRRRC 209
            :.|:...|:.|:||||||||:..|.|.|.|..|:|  |....|..:|.||.:|.|.|:..:|:..
  Fly   134 NALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPF 198

  Fly   210 ESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGF--SK 272
            ..:.:||.|...|:::..|.:.|.:|.....|..:.:|.|:|||.|.|.::.||.||||.|  .|
  Fly   199 SQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGK 263

  Fly   273 STQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGRE 337
            |.:.:|.:|||.:|||||.|||.:|:.||.||..:.::|||.|.|:........||:.::|.|..
  Fly   264 SNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGER 328

  Fly   338 KSVTIHQSFVLSDP 351
            ..|...:||  |.|
  Fly   329 TRVESFKSF--SSP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 43/79 (54%)
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 69/131 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440108
Domainoid 1 1.000 88 1.000 Domainoid score I5039
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.