DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Art9

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_650321.1 Gene:Art9 / 41698 FlyBaseID:FBgn0038188 Length:313 Species:Drosophila melanogaster


Alignment Length:304 Identity:89/304 - (29%)
Similarity:155/304 - (50%) Gaps:23/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEF 104
            |:.:.:|.|.:..:||....:..| .|:.|.||||||..|:||:.:.:||:.:|:|:.....:||
  Fly    10 EMADSMLNDVISTRAYEWVFKRYERLFKDKIVLDVGCRSGLLSLMSVEAGAVKVMALGNRESAEF 74

  Fly   105 AQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSAT 169
            ..:.....|...:.:.|.|.:.:|.||.|:|||||||.:|:|..:|..::.:.::|||:|||...
  Fly    75 VSKAFIGTEKEDIFEFIDGDIHEIVLPCGLKKVDIIVSEWVGHSVFVDSLFKEVIFAREKWLVKG 139

  Fly   170 GHIYPDTAQLYLAAIKGRDQDLGFWHDVHGFDLSAIRR----------RCESKAVVEHVTGDQMM 224
            |.|.|:.|||::..|..        |.....:::.:.:          |.....:.::|..:|::
  Fly   140 GFIIPNVAQLFVCGIAD--------HPRKTVEVNILPQSDYPGRSYMVREPVSLIEDYVAKEQLI 196

  Fly   225 SRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGF--SKSTQRISFSTSPSAPW 287
            :...|:|::||.|........|..|:|:..|:..:..:|.|.|:|.  .:...|:.|||.|..|.
  Fly   197 TEKYLLKTIDLCTAHINDESFRVPFKLRGLRDSQLGAVVLYSDIGLCRPRGKFRLMFSTGPKRPR 261

  Fly   288 THWNQTVFYLETPLPVRAGECIKGVLTM--KPSEDSIFDTEFDI 329
            |:..||:.:::.|:.|...|.:.|.|.|  ||.|....:..|.:
  Fly   262 TYVRQTILFMDNPVEVAKCELVIGELGMYYKPDEHREVEYSFSL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 31/79 (39%)
Art9NP_650321.1 AdoMet_MTases 41..143 CDD:100107 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S417
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.