DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and gstcd

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001019633.1 Gene:gstcd / 402871 ZFINID:ZDB-GENE-050320-41 Length:614 Species:Danio rerio


Alignment Length:219 Identity:45/219 - (20%)
Similarity:79/219 - (36%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSC--LFSGNMLESLLFARDKWLSA 168
            ||:  ||....|:...|.....::...|...|.|::...:..|  :...|..|||:.||::    
Zfish   406 QQL--DNLLAMVLNQAQPGHTVVDFCSGGGHVGIVLAYMLPKCQVILVENKEESLIRARER---- 464

  Fly   169 TGHIYPDTAQLYLAAIKGRDQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSL 233
                   :|||.|..|.....:|.::  ...|::......|       .|..|.::.| ||    
Zfish   465 -------SAQLTLTNIGFIQTNLDYF--TGNFNIGVALHAC-------GVATDMVLDR-CL---- 508

  Fly   234 DLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLE 298
                               .:|.|:|.....|   ||.::|.:.:|..|     ..:.:|:.|.|
Zfish   509 -------------------QARAGFVISPCCY---GFIQNTLKFNFPKS-----ARFAETLSYKE 546

  Fly   299 TPLPVRAGECIKGVLTMKPSEDSI 322
            ..:..|..:  :..:::.|...||
Zfish   547 HMILCRFAD--QTAVSLPPERRSI 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 10/45 (22%)
gstcdNP_001019633.1 AdoMet_MTases 403..521 CDD:327401 32/160 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.