DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt3

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_988966.1 Gene:prmt3 / 394563 XenbaseID:XB-GENE-946963 Length:519 Species:Xenopus tropicalis


Alignment Length:289 Identity:122/289 - (42%)
Similarity:187/289 - (64%) Gaps:7/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAV 96
            ||..||...|||.:|||:||.::||:.:..| ..|:.|||||||||.|:|||||||||:|:|:.|
 Frog   208 YFSSYGHFGIHEEMLKDTVRTESYRDFMYQNPHIFKDKTVLDVGCGTGILSMFAAKAGAKKVIGV 272

  Fly    97 EAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFA 161
            :.:.|...|..:|:.|.....:.:::|:|||::||  ::|||||:.:|||..|...:||:|::.|
 Frog   273 DQSDIIYQAMDIVRLNGLEDTVSLVKGRVEDVDLP--VEKVDIIISEWMGYFLLFESMLDSVICA 335

  Fly   162 RDKWLSATGHIYPDTAQLYLAAIKGRDQDLG---FWHDVHGFDLSAIRRRCESKAVVEHVTGDQM 223
            |||:|:..|.:||||..:.|.|:....:..|   ||.:|:||::|.:::....:||||.|..:..
 Frog   336 RDKYLNEDGAVYPDTCTMSLVALSDETKHAGKIAFWENVYGFNMSCMKKCVIPEAVVEVVKAETQ 400

  Fly   224 MSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQR-ISFSTSPSAPW 287
            :|...::|:::..|...:.....|.|.|.|:|:.....|..||||.|.:|.:| :|||||||...
 Frog   401 ISEPSIIKNINCQTATIKDLDFASDFSLSVTRDAPCTALAGYFDVCFERSCERAVSFSTSPSCTK 465

  Fly   288 THWNQTVFYLETPLPVRAGECIKGVLTMK 316
            |||.||||.||.|:|.:||:.::|.:|::
 Frog   466 THWKQTVFMLEKPIPAKAGDVLEGRITVR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 39/79 (49%)
prmt3NP_988966.1 AdoMet_MTases 246..347 CDD:100107 49/102 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.