DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt7

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_956797.2 Gene:prmt7 / 393475 ZFINID:ZDB-GENE-040426-1560 Length:683 Species:Danio rerio


Alignment Length:331 Identity:72/331 - (21%)
Similarity:132/331 - (39%) Gaps:52/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KDDEKMDGNHTDAN----QIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNEFFR 67
            ::.|:.|.:...|.    .::.|:.|.|::|..:...:.          |:||..|         
Zfish    19 EESEEYDYHQEIARSCYADMLHDKDRNEKYYEGIRAAVR----------RVKARGE--------- 64

  Fly    68 HKTVLDVGCGMGVLSMFAAKAGSKRVLAVEA-ATISEFAQQVVQDNEFGRVIQVIQGKVEDIEL- 130
            ...|||:|.|.|:|||.|..||:....|:|. ..:::.|..:|:.|.|...|::|.....::.: 
Zfish    65 RPVVLDIGTGTGLLSMMAVTAGADFCYAIEVFKPMAQAASCIVERNGFSDKIKIINKHSTEVTVG 129

  Fly   131 PDG--IKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDLGF 193
            |||  .::.:|:|.:...:.|.....|.|...|....:.......|..|.:|...::  ...|..
Zfish   130 PDGDMQERANILVTELFDTELIGEGALPSYEHAHMHLVQTGCEAVPHRATIYAQLVE--SDMLWK 192

  Fly   194 WHDVHGFDLSAIR-------RRCESKAVVEHVTGDQM-------MSRVCLVKSLDLYTEPRQSAK 244
            |..:...|:...|       :.|.....|..:...|:       :|.||.:.|:| :::|..||.
Zfish   193 WAQMRPIDVDGHRLMPPGAVQECAGAPSVCDIQLSQVPTDAFTAISPVCTMFSVD-FSKPVSSAA 256

  Fly   245 SRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRI-------SFSTSPSAPW-THWNQTVFYLETPL 301
            .......|....|....:::::|:........:       |::...:.|| .||.|:|::|....
Zfish   257 QSYTVRFKSQTGGRAQVVLSWWDIDMDPEGNIVCTMAPSWSYADPHAYPWRDHWMQSVYFLPAEE 321

  Fly   302 PVRAGE 307
            .|..||
Zfish   322 NVSEGE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 25/83 (30%)
prmt7NP_956797.2 AdoMet_MTases 54..>189 CDD:302624 36/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.