DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Art7

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster


Alignment Length:356 Identity:80/356 - (22%)
Similarity:143/356 - (40%) Gaps:76/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IHEWLLKDSVRIKAYREAIQ-HNEFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEA-ATISEF 104
            :|:| .::.....|.|:.|. ..|..|...|||:|.|.|:|||.|..||:..|.|.|| ..::..
  Fly    39 LHDW-ERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMANC 102

  Fly   105 AQQVVQDNEFGRVIQVIQGKVEDIELPDGI-KKVDIIVCDWMGSCLFSG------NMLESLLFAR 162
            |::::..|..|..:::|:.:..:|::.:.: :|.:::|.:.:.:.|...      |...:.|...
  Fly   103 AEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTE 167

  Fly   163 DK-WLSATGHIYPDTAQLYLAAIKGRDQDLGFWHD---VHGFDLSAI------RRRCESKAVVEH 217
            |. .:.|....|...||..|||         .|:.   :...|...:      .:.|:.:|.:..
  Fly   168 DALCIPARARCYAQVAQSPLAA---------QWNSLKTIANLDGEPLLHPPEQLKSCQGEAALHD 223

  Fly   218 VTGDQMMSRVC--LVKSLDL----YTEPRQSAKSRS-LFELKVSRNGWVHGLVAYFDVGFSKSTQ 275
            |...|:.|...  |...:::    :...::..|.|| |.:|:..:.|....:..::|:......:
  Fly   224 VQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGE 288

  Fly   276 RISFSTSP----------------------SAPW-THWNQTVFYLETPLP-VRAGECIKGVLTMK 316
             |..|.:|                      ..|| .||.|.::|:..||. :.||         |
  Fly   289 -ILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYIPKPLQLLEAG---------K 343

  Fly   317 PSEDSIFDTEFDIFVNFDGRE----KSVTIH 343
            ....|....|:.::  ||.||    |||..|
  Fly   344 SFHLSCHHDEYSLW--FDAREEAPTKSVRRH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 23/81 (28%)
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 38/147 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.