powered by:
Protein Alignment Art2 and CG17807
DIOPT Version :9
Sequence 1: | NP_001285600.1 |
Gene: | Art2 / 33631 |
FlyBaseID: | FBgn0031592 |
Length: | 355 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611690.2 |
Gene: | CG17807 / 37585 |
FlyBaseID: | FBgn0034748 |
Length: | 615 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 14/61 - (22%) |
Similarity: | 21/61 - (34%) |
Gaps: | 22/61 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 EIHEWLLKDSVRI------KAYREAIQHNEFFRH----------------KTVLDVGCGMG 79
|:|..|...::.: :.|.:...|....|| ..|||:|||.|
Fly 347 ELHASLAAQAITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNG 407
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.