DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Bud23

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001129215.1 Gene:Bud23 / 368084 RGDID:1589742 Length:281 Species:Rattus norvegicus


Alignment Length:268 Identity:49/268 - (18%)
Similarity:83/268 - (30%) Gaps:105/268 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLDVGCGMGVLSMFAAKAGSKRV-LAVEAATISEFAQQVVQDN----EFGRVIQVIQGKVEDIEL 130
            :||:|||.|:...:.::.|...| :.:..|.:.....:..:.:    :.|:.:....|..     
  Rat    57 LLDIGCGSGLSGDYISEEGHYWVGIDISPAMLDAALDRDTEGDLLLGDMGQGVPFRPGSF----- 116

  Fly   131 PDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDLGFWH 195
             ||.  :.|....|    |.:.|....:...|         :|...:.||.|.::|         
  Rat   117 -DGC--ISISAVQW----LCNANKKSDIPARR---------LYCFFSSLYSALVRG--------- 156

  Fly   196 DVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVH 260
                           ::||                  |.||.|   :::...|...:.:|.|:..
  Rat   157 ---------------ARAV------------------LQLYPE---NSEQLELITTQATRAGFTG 185

  Fly   261 GLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYL------ETPLPVRAGECIKGVLTMKPSE 319
            |:|             :.|..|..|       ..|||      .|.||       || ||.....
  Rat   186 GVV-------------VDFPNSAKA-------KKFYLCLFSGPSTSLP-------KG-LTESQEA 222

  Fly   320 DSIFDTEF 327
            |...::.|
  Rat   223 DQASESAF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 15/83 (18%)
Bud23NP_001129215.1 UbiG 18..>91 CDD:225137 9/33 (27%)
Methyltransf_11 58..>128 CDD:400514 15/81 (19%)
WBS_methylT 204..279 CDD:403702 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.