DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Mettl7b

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001019447.1 Gene:Mettl7b / 366792 RGDID:1305205 Length:244 Species:Rattus norvegicus


Alignment Length:74 Identity:18/74 - (24%)
Similarity:33/74 - (44%) Gaps:4/74 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDI-ELPDG 133
            |:|::|||.|....| ...|.|...........:|..:.:.:|...:..:.|....|:: :|.| 
  Rat    73 TLLELGCGTGANFQF-YPPGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLAD- 135

  Fly   134 IKKVDIIVC 142
             ..:|::||
  Rat   136 -SSMDVVVC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 18/74 (24%)
Mettl7bNP_001019447.1 Methyltransf_11 75..172 CDD:285453 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.