powered by:
Protein Alignment Art2 and Mettl7b
DIOPT Version :9
Sequence 1: | NP_001285600.1 |
Gene: | Art2 / 33631 |
FlyBaseID: | FBgn0031592 |
Length: | 355 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001019447.1 |
Gene: | Mettl7b / 366792 |
RGDID: | 1305205 |
Length: | 244 |
Species: | Rattus norvegicus |
Alignment Length: | 74 |
Identity: | 18/74 - (24%) |
Similarity: | 33/74 - (44%) |
Gaps: | 4/74 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 TVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDI-ELPDG 133
|:|::|||.|....| ...|.|...........:|..:.:.:|...:..:.|....|:: :|.|
Rat 73 TLLELGCGTGANFQF-YPPGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLAD- 135
Fly 134 IKKVDIIVC 142
..:|::||
Rat 136 -SSMDVVVC 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.