DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Alkbh8

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001178838.1 Gene:Alkbh8 / 366783 RGDID:1304687 Length:664 Species:Rattus norvegicus


Alignment Length:379 Identity:68/379 - (17%)
Similarity:108/379 - (28%) Gaps:159/379 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QEEHYFKLYGRIEIHEWLLKDS--VRIKAYREAIQHNEFFRHKTVLDVGCGMGVLSMFAAKAGSK 91
            :::|...:|..|..|....:.|  .||..:.:|:.....     |.|:|||.|      ...|..
  Rat   371 EQKHVHHVYDEIASHFSSTRHSPWPRIVEFLKALPSGSI-----VADIGCGNG------KYLGIN 424

  Fly    92 RVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWM------GSC-- 148
            :.|.:.....|.....:.::.:|                       ..:|||.:      |||  
  Rat   425 KELYMIGCDRSRNLVDICRERQF-----------------------QALVCDALAVPVRSGSCDA 466

  Fly   149 --------------------------LFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR 187
                                      |.||.  ::|::.   |  |....|.|....||...:..
  Rat   467 CISIAVIHHFATAERRVEALQEIARLLRSGG--QALIYV---W--AMEQEYRDQKSKYLKGNRIS 524

  Fly   188 DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPR---QSAKSRSLF 249
            ..|.|               ...|...:|.:..:||...|.....|.:::...   :..|||.:.
  Rat   525 QGDKG---------------ELNSATSMEQLLVNQMPEGVSEDPGLSVHSSNNTKDEECKSRKVL 574

  Fly   250 ELKVSRNGWVHGLVAYFDVGFSKSTQRISF-STSPSAPWTHWNQTVFYLETPLPVRAGECIKGVL 313
            ..::.    :|             |.|..| |.....|| |                   :||  
  Rat   575 NSELP----IH-------------TNRTCFHSQDVLVPW-H-------------------LKG-- 600

  Fly   314 TMKPSEDS---------------IFDTEFDIFVNFDGREKS------VTIHQSF 346
              ||.:|.               :|...:.:|.|.: .|.|      |:|.|||
  Rat   601 --KPGKDKAVEQSGLARCPDPRPVFHRYYHVFCNGE-LEASCQAVGDVSILQSF 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 16/113 (14%)
Alkbh8NP_001178838.1 DUF1891 1..37 CDD:117570
RRM_ALKBH8 42..122 CDD:240877
2OG-FeII_Oxy 152..334 CDD:304390
Methyltransf_11 412..501 CDD:285453 18/119 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.