DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Carm1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001025212.1 Gene:Carm1 / 363026 RGDID:1305879 Length:608 Species:Rattus norvegicus


Alignment Length:346 Identity:119/346 - (34%)
Similarity:185/346 - (53%) Gaps:33/346 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HTDANQIIKDRRRQEE--HYFKLYGRIEIHEWLLKDSVRIKAYREAI-QHNEFFRHKTVLDVGCG 77
            ||....:..:|..:..  .||:.||.:...:.:::|.||...|:.|| |::..|:.|.|||||||
  Rat   131 HTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCG 195

  Fly    78 MGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVC 142
            .|:||.|||:||::::.||||:|:::.|:.:|:.|.....|.||.||||::.||:   :||||:.
  Rat   196 SGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPE---QVDIIIS 257

  Fly   143 DWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDL--------GFWH--DV 197
            :.||..||:..||||.|.|: |:|..:|:::|....::||..  .|:.|        .||:  ..
  Rat   258 EPMGYMLFNERMLESYLHAK-KYLKPSGNMFPTIGDVHLAPF--TDEQLYMEQFTKANFWYQPSF 319

  Fly   198 HGFDLSAIRRRCESKAVVEHV---TGDQMMSRVCLVKSLDLYTEPRQSAKSRSL------FELKV 253
            ||.||||:|    ..||.|:.   ..|....|:.:.||:. ||.....||...|      |:..:
  Rat   320 HGVDLSALR----GAAVDEYFRQPVVDTFDIRILMAKSVK-YTVNFLEAKEGDLHRIEIPFKFHM 379

  Fly   254 SRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPS 318
            ..:|.||||..:|||.|..|...:..||:|:.|.|||.|.....::||..:||:.:.|...:..:
  Rat   380 LHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIAN 444

  Fly   319 EDSIFDTEFDIFVNFDGREKS 339
            :...:|......|:..|.:.|
  Rat   445 KRQSYDISIVAQVDQTGSKSS 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 38/79 (48%)
Carm1NP_001025212.1 CARM1 35..139 CDD:402914 2/7 (29%)
AdoMet_MTases 189..284 CDD:100107 48/98 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.