DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Prmt7

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:343 Identity:78/343 - (22%)
Similarity:133/343 - (38%) Gaps:60/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELAKDDEKMDGNHTDANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNEFFRH 68
            |..::||..|.:...|.....|....::...|.|..|......:||..: ||             
  Rat    16 EWLEEDEHYDYHQEIARSSYADMLHDKDRNIKYYQGIRAAVSRVKDKGQ-KA------------- 66

  Fly    69 KTVLDVGCGMGVLSMFAAKAGSKRVLAVEA-ATISEFAQQVVQDNEFGRVIQVIQGKVEDIEL-P 131
             .|||:|.|.|:|||.|..||:....|||. ..::|.|.::|:.|.|...|:||.....::.: |
  Rat    67 -LVLDIGTGTGLLSMMAVTAGADFCYAVEVFKPMAEAAVKIVEKNGFSDKIKVINKHSTEVTVGP 130

  Fly   132 DGIK--KVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDLGFW 194
            ||..  :.:|:|.:...:.|.....|.|...|....:.......|..|.:|...::.:  .:..|
  Rat   131 DGDLPCRANILVTELFDTELIGEGALPSYEHAHKHLVQEDCEAVPHRATVYAQLVESK--RMWSW 193

  Fly   195 HDVHGFDLSAIR----------------RRCESKAVVEHVTGDQ-------MMSRVCLVKSLDLY 236
            :     .|..:|                .||.....|..:..:|       ::|.|..:.|:|..
  Rat   194 N-----KLFPVRVQTGLGEQLIIPPSELERCPGAPSVYDIQLNQVSPADFTVLSDVLPMFSVDFS 253

  Fly   237 TEPRQSAKSRSLFELKVSRNGWVHGLVAYFDV-----GFSKSTQRISFS-TSP-SAPW-THWNQT 293
            .:...||...|...:.:: :|....:::::|:     |..|.|....:: |.| ...| .||.|.
  Rat   254 KQVSSSAACHSKQFVPLA-SGQAQVVLSWWDIEMDPEGKIKCTMAPFWAQTDPQELQWRDHWMQC 317

  Fly   294 VFYLETPLPVRAG--ECI 309
            |::|....|:..|  .|:
  Rat   318 VYFLPQEEPIMQGSPRCL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 28/83 (34%)
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624 43/165 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.