DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and CG10428

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster


Alignment Length:169 Identity:34/169 - (20%)
Similarity:57/169 - (33%) Gaps:49/169 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 VEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKG--- 186
            ::|::||...|..:..:.   |:|.....     |.||.          |:.....|...||   
  Fly    81 IQDLKLPIYEKDGNTFIA---GTCAVCRE-----LIARQ----------PNEELKKLLGFKGSCL 127

  Fly   187 -RDQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTG-----DQMMSRVCLVKSLDLYTEPRQSAKS 245
             ...:...|......||.|:..:..|..|:|.|..     :|.|:..  |:..::|.:.|:.|..
  Fly   128 LAPSEASIWTKFCEVDLVAVVSKLHSGQVLEFVPQEVVRFEQHMNEP--VRMHNIYKQAREQANQ 190

  Fly   246 RSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFS-TSP 283
                    :.||           |..|..:|:... |:|
  Fly   191 --------TENG-----------GKVKRRERVQIKCTTP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 6/24 (25%)
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.