DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Art8

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:318 Identity:103/318 - (32%)
Similarity:161/318 - (50%) Gaps:34/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAV 96
            ||..|..:||||.:|||..|.:||..||..| :.|:.|.|:|||.|.|:||.|.||||::.|.||
  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69

  Fly    97 EAATI-SEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLF 160
            ||:.: ::.|..:::||....|::|||.:||:..||...:||||||.:|||..|....||:|:|.
  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134

  Fly   161 ARDKWLSATGHIYPDTAQLYLA--AIKGRDQDLGFWHDVHGFDLSAIRRRC----ESKAVVEHVT 219
            ||||:|...|.::|....:::|  ::.....|   ||:|.|..:....|:.    .|:..:..:.
  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD---WHNVDGIKMDTFARKLRTQKSSRPEITQLN 196

  Fly   220 GDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVH-GLVAYFDVGFSKSTQRISFSTSP 283
            ...::....:...::|.........|....|:..::....| |...:|||.|  ..:....||||
  Fly   197 PQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQF--PGEDFVLSTSP 259

  Fly   284 SAPWTHWNQTVFYL----------ETPLPVRAGECIKGVLTMKPSEDSI--FDTEFDI 329
            .:|.|||.|.|..|          ::|:..:        :|||.|...:  ::.|.|:
  Fly   260 LSPPTHWKQCVVVLPEESCENLEEKSPIAFQ--------ITMKRSAADMRKYNLEVDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 38/80 (48%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 81/241 (34%)
Methyltransf_18 40..147 CDD:289607 50/106 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.