DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001527.3 Gene:PRMT1 / 3276 HGNCID:5187 Length:371 Species:Homo sapiens


Alignment Length:343 Identity:144/343 - (41%)
Similarity:221/343 - (64%) Gaps:20/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LEEL----AKDDEKMDGNHTDANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQH 62
            |||:    |:..||.:.          :....:::||..|....|||.:|||.||...||.::.|
Human    28 LEEVSCGQAESSEKPNA----------EDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFH 82

  Fly    63 N-EFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVE 126
            | ..|:.|.|||||.|.|:|.|||||||:::|:.:|.::||::|.::|:.|:...|:.:|:||||
Human    83 NRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVE 147

  Fly   127 DIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---D 188
            ::|||  ::|||||:.:|||.|||..:||.::|:||||||:..|.|:||.|.||:.||:.|   |
Human   148 EVELP--VEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD 210

  Fly   189 QDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKV 253
            ..:.:|.:|:|||:|.|:.....:.:|:.|...|:::..||:|.:|:||...:.....|.|.|:|
Human   211 YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQV 275

  Fly   254 SRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPS 318
            .||.:||.|||||::.|::..:|..|||||.:|:|||.|||||:|..|.|:.||.|.|.:.|:|:
Human   276 KRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPN 340

  Fly   319 EDSIFDTEFDIFVNFDGR 336
            ..:..|.:|.|.::|.|:
Human   341 AKNNRDLDFTIDLDFKGQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 40/79 (51%)
PRMT1NP_001527.3 AdoMet_MTases 92..192 CDD:100107 52/101 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S417
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.