DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_956944.2 Gene:prmt1 / 321974 ZFINID:ZDB-GENE-030131-693 Length:348 Species:Danio rerio


Alignment Length:311 Identity:135/311 - (43%)
Similarity:211/311 - (67%) Gaps:6/311 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRV 93
            :::||..|....|||.:|||.||...||.::.||: .|:.|.|||||.|.|:|.|||||||:|:|
Zfish    27 KDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKV 91

  Fly    94 LAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESL 158
            :.:|.::||::|.::|:.|:...::.:|:||||::|||  ::.||||:.:|||.|||..:||.::
Zfish    92 IGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELP--VENVDIIISEWMGYCLFYESMLNTV 154

  Fly   159 LFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTG 220
            ::||||||...|.|:||.|.||:.||:.|   |..:.:|.:|:|||:|.|:....::.:|:.|..
Zfish   155 IYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAITEPLVDVVDP 219

  Fly   221 DQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSA 285
            .|::|..||:|.:|:||...:.....|.|.|:|.||.::|.||.||::.|::..:|..|||||.:
Zfish   220 KQLVSTACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSPES 284

  Fly   286 PWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGR 336
            |:|||.||||||:..|.|:.||.|.|.::|||:..:..|.:|.:.::|.|:
Zfish   285 PYTHWKQTVFYLDDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 39/79 (49%)
prmt1NP_956944.2 Methyltransf_18 65..169 CDD:289607 51/105 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.