DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Trmt9b

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001371028.1 Gene:Trmt9b / 319582 MGIID:2442328 Length:447 Species:Mus musculus


Alignment Length:77 Identity:20/77 - (25%)
Similarity:31/77 - (40%) Gaps:14/77 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 WHDVHGFDLSAIRRRCESKAVVE------HVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELK 252
            |......|.|.:|::.|....::      :.|..|..||   ..||||:.....|.|..:|.|:.
Mouse   248 WFFSRSLDESTLRKQIERVRPMKIPEAWANSTVSQQPSR---HPSLDLHAPEPFSTKGPNLDEVF 309

  Fly   253 VSRN-----GWV 259
            |..:     ||:
Mouse   310 VDTSSQRHLGWL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107
Trmt9bNP_001371028.1 Methyltransf_25 48..135 CDD:404528
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..306 10/34 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..348 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.