DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and CG32152

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster


Alignment Length:397 Identity:113/397 - (28%)
Similarity:187/397 - (47%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELAKDDEKMDGNHTDANQIIK-------------------------------------------- 24
            |..|..||:| |...|||.:|                                            
  Fly   101 ERKKHSEKLD-NSKSANQTVKPENSDIKISLLQRPNPQDATQARSKTRVRSAGRIPAPPRKVPKE 164

  Fly    25 ----DRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQH-NEFFRHKTVLDVGCGMGVLSMF 84
                ||....:.......|:::.....||...:..::..|.| ....:.:|:|.:.||.|.|::.
  Fly   165 LEDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALM 229

  Fly    85 AAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCL 149
            ||:.|:|||.||:.:.::.:...||:.|.:..||.|:.|:::|::||   .|||.|:|:|||.||
  Fly   230 AAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLP---TKVDGIICNWMGYCL 291

  Fly   150 FSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAI---KGRDQDLGFWHDVHGFDLSAIRRRCES 211
            ...:.:..:|.|||:||...|.|.||.|.|||.|.   |.:.:....|.:|:||:::||||...:
  Fly   292 LYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALA 356

  Fly   212 KAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLF-----ELKVSRNGWVHGLVAYFDVGFS 271
            :..|...||.::::....|..|||     :.|:...||     .|.|:|.|::...:.:|:|.||
  Fly   357 EPCVALTTGKKLLTMAHCVLRLDL-----KRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFS 416

  Fly   272 KSTQ-RISFSTSPSAPW-THWNQTVFYLETPLPVRAGECIKGVL---TMKPSEDSIFDTEFDIFV 331
            .|.. ::|.:....:|: :.|.|:|.::|.|..:|......|.|   |:||::.:    |.:|.:
  Fly   417 NSLNFKLSCNPCLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFN----EMEICI 477

  Fly   332 NF-DGRE 337
            .| :|||
  Fly   478 EFYEGRE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 33/79 (42%)
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 41/102 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440107
Domainoid 1 1.000 84 1.000 Domainoid score I1911
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.