DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Antkmt

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001120919.1 Gene:Antkmt / 287150 RGDID:1306126 Length:222 Species:Rattus norvegicus


Alignment Length:168 Identity:36/168 - (21%)
Similarity:68/168 - (40%) Gaps:40/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GCGMGVLSMFA--AKAGSKRV-LAVEAATISEFAQQVVQDNEFGRVIQVIQ---GKVEDIELPDG 133
            |.|:.|.:::|  .:.|.:|| |.::...|...|:||  :|    |:.:::   ||:.|:...||
  Rat    29 GSGLAVYTVWALLLQPGFRRVPLRLQVPYIGASARQV--EN----VLSLLRGRPGKMVDLGSGDG 87

  Fly   134 IKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKG----RDQDLGFW 194
            ...:....|          .:..::.:..:.||.....::     .:.|...|    ..:||  |
  Rat    88 RIVLAAHQC----------GLRPAVGYELNPWLVGLARLH-----AWRAGCSGSVCYHRKDL--W 135

  Fly   195 -------HDVHGFDLSAIRRRCESKAVVEHVTGDQMMS 225
                   |:|..|...::....|.|..||...|.:::|
  Rat   136 KVSLRDCHNVSVFLAPSVLPLLEDKLQVELPAGARVVS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 20/80 (25%)
AntkmtNP_001120919.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.