DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and rmt3

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_595572.1 Gene:rmt3 / 2541248 PomBaseID:SPBC8D2.10c Length:543 Species:Schizosaccharomyces pombe


Alignment Length:362 Identity:118/362 - (32%)
Similarity:189/362 - (52%) Gaps:20/362 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LEELAKDD-EKMDGNHTDANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE- 64
            |||:.||. .::....||...:...:...:.:||:.|...:||..:|.||||.:.||:.:.||: 
pombe   188 LEEIRKDKMNELTSQTTDQLSVTPKKADNDSYYFESYAGNDIHFLMLNDSVRTEGYRDFVYHNKH 252

  Fly    65 FFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIE 129
            .|..|||||||||.|:||||.||||:|:|.||:.:.|.:.|.....:|.....|..|:||:|||.
pombe   253 IFAGKTVLDVGCGTGILSMFCAKAGAKKVYAVDNSDIIQMAISNAFENGLADQITFIRGKIEDIS 317

  Fly   130 LPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDL 191
            ||.|  |||||:.:|||..|...:|::|:|.|||::|:.:|.:.|...:|.|.|....   ::.:
pombe   318 LPVG--KVDIIISEWMGYALTFESMIDSVLVARDRFLAPSGIMAPSETRLVLTATTNTELLEEPI 380

  Fly   192 GFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRN 256
            .||.||:||.::.::........|:.|....:.::..:....:::|...|.....|.|.|.:...
pombe   381 DFWSDVYGFKMNGMKDASYKGVSVQVVPQTYVNAKPVVFARFNMHTCKVQDVSFTSPFSLIIDNE 445

  Fly   257 GWVHGLVAYFDVGF-SKSTQRI--------SFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGV 312
            |.:.....:||..| :|.||.|        .|:|.|....|||.|.|..|.....::.|..::|.
pombe   446 GPLCAFTLWFDTYFTTKRTQPIPEAIDEACGFTTGPQGTPTHWKQCVLLLRNRPFLQKGTRVEGT 510

  Fly   313 LTMKPSEDSIFDTEFDIFVNFDGREKSVTIHQSFVLS 349
            ::...::.:..|.:..:..|.:|:..|    ||:||:
pombe   511 ISFSKNKKNNRDLDISVHWNVNGKADS----QSYVLN 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 42/79 (53%)
rmt3NP_595572.1 zf-C2H2_2 60..>113 CDD:289522
Methyltransf_18 255..369 CDD:289607 55/115 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.