DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt-1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_507909.1 Gene:prmt-1 / 180326 WormBaseID:WBGene00013766 Length:348 Species:Caenorhabditis elegans


Alignment Length:325 Identity:133/325 - (40%)
Similarity:207/325 - (63%) Gaps:11/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTVLDVGCGMGVLSMFAAKAGSKRV 93
            :::||..|....|||.:|||.||...||.:|.|| ..|:.|.|:|||.|.|:|||||||||:|:|
 Worm    24 KDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAKKV 88

  Fly    94 LAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDI-ELPDGIKKVDIIVCDWMGSCLFSGNMLES 157
            .|:|.:.::..:::::.||....:::|||.||||: |||.||:|||||:.:|||.|||..:||.:
 Worm    89 FAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNT 153

  Fly   158 LLFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVT 219
            :|.|||:||:..|.::||.|:||:.||:.|   :..:.:|..|:||::|||:.....:.:|:.|.
 Worm   154 VLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVD 218

  Fly   220 GDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPS 284
            ..|:.:..||:|.:||||...:....:|.|:|:.:|:.::...|.:|.|.|||..::..|||.|.
 Worm   219 NAQVNTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTGFSTGPD 283

  Fly   285 APWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDG------REKSVTIH 343
            ..:|||.||||||:..|.|:.||.|.|...|.|::::..|.:.:|..:|.|      .:.:.|:|
 Worm   284 VQYTHWKQTVFYLKDALTVKKGEEITGSFEMAPNKNNERDLDINISFDFKGEVCDLNEQNTYTMH 348

  Fly   344  343
             Worm   349  348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 42/80 (53%)
prmt-1NP_507909.1 AdoMet_MTases 66..169 CDD:100107 53/102 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5039
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S417
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.