DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and R08F11.4

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_504052.1 Gene:R08F11.4 / 178797 WormBaseID:WBGene00019968 Length:354 Species:Caenorhabditis elegans


Alignment Length:211 Identity:47/211 - (22%)
Similarity:63/211 - (29%) Gaps:94/211 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIK 135
            |||||||.|..|...|:...|          |:|..           :.:.:..::...|.   |
 Worm   169 VLDVGCGGGFHSGLLAEHYPK----------SQFVG-----------LDITEKAIKAARLK---K 209

  Fly   136 KVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDLGFWHDVHGF 200
            |.|             |...|:|.|     :.|...|.|.:                 |.|  .|
 Worm   210 KSD-------------GTDFENLEF-----VVADAAIMPSS-----------------WTD--SF 237

  Fly   201 DLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAY 265
            ||..:...|.          |||...:||                     |:|.|.....||||.
 Worm   238 DLVILFGSCH----------DQMRPDLCL---------------------LEVHRVVKPDGLVAV 271

  Fly   266 FDVGFSKS--TQRISF 279
            .||..|.:  |.|.::
 Worm   272 TDVDGSSNVFTDRETY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 17/78 (22%)
R08F11.4NP_504052.1 Methyltransf_31 165..>281 CDD:316372 45/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.