DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Art2 and C27F2.4

DIOPT Version :9

Sequence 1:	NP_001285600.1	Gene:	Art2 / 33631	FlyBaseID:	FBgn0031592	Length:	355	Species:	Drosophila melanogaster
Sequence 2:	NP_498051.1	Gene:	C27F2.4 / 175671	WormBaseID:	WBGene00016166	Length:	283	Species:	Caenorhabditis elegans

Alignment Length:	137	Identity:	35/137 - (25%)
Similarity:	50/137 - (36%)	Gaps:	22/137 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 VLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELP---- 131
            :||:|||.|:.|.....||...|....:..:.|.|:| .:|.|.|..|....|    :.:|
Worm    57 LLDIGCGTGMSSEVILDAGHMFVGVDVSRPMLEIARQ-DEDLESGDFIHQDMG----LGMPFRPG 116

  Fly   132 --DGIKKVDIIVCDWMGSCLFSG-NMLESLLFARDKWLSATG-------HIYPDTAQLYLAAIKG 186
              ||  .:.|....|:.....|. |..:.|||.........|       ..||:..: ....|.|
Worm   117 SFDG--AISISAIQWLCHANASDENPRKRLLFFFQSLYGCLGRGSRAVFQFYPENDE-QCDLIMG 178

  Fly   187 RDQDLGF 193
            :....||
Worm   179 QAHKAGF 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Art2	NP_001285600.1	AdoMet_MTases	70..>150	CDD:100107	23/84 (27%)
C27F2.4	NP_498051.1	SmtA	23..253	CDD:223574	35/137 (26%)
		Methyltransf_11	58..163	CDD:285453	29/111 (26%)
		WBS_methylT	206..281	CDD:289366
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900