DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and METTL27

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_016867266.1 Gene:METTL27 / 155368 HGNCID:19068 Length:271 Species:Homo sapiens


Alignment Length:156 Identity:33/156 - (21%)
Similarity:56/156 - (35%) Gaps:39/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIK 135
            :|||.||.|:::......|..::..|:.:  ....:|......:.|:.....|: |.:..|:|..
Human    71 ILDVACGTGLVAAELRAPGFLQLHGVDGS--PGMLEQAQAPGLYQRLSLCTLGQ-EPLPSPEGTF 132

  Fly   136 KVDIIV---CDWMGSCLFSGNMLESL--------LFARD---KWLSATGHI-YP----------- 174
            ...:||   .|....|    |.:..|        :.:||   .||....|: ||           
Human   133 DAVLIVGALSDGQVPC----NAIPELHVTKPGTTIPSRDGPGLWLLPLPHLTYPSPPGGLVCLTT 193

  Fly   175 --DTAQLY----LAAIKGRDQDLGFW 194
              :::.|.    |.|...|.:..|.|
Human   194 RTNSSNLQYKEALEATLDRLEQAGMW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 18/81 (22%)
METTL27XP_016867266.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.