DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt9

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_012813001.1 Gene:prmt9 / 100216218 XenbaseID:XB-GENE-5998444 Length:838 Species:Xenopus tropicalis


Alignment Length:325 Identity:88/325 - (27%)
Similarity:153/325 - (47%) Gaps:54/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EEHYFKLYGRIEIHEW---LLKDSVRIKAYREAIQHNEFFRHKTVLDVGCGMGVLSMFAAKAGSK 91
            :|:::::...: |..|   :|.|:.|...|:||||:......|||||:|.|.|:|||||.|||:.
 Frog   138 KENFYRVANWL-IERWHFIMLNDTKRNLMYQEAIQNAIQNGCKTVLDIGTGTGILSMFAKKAGAS 201

  Fly    92 RVLAVE-AATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGI-KKVDIIVCDWMGSCLFSGNM 154
            ...|.| :.|:.|.|.:|:..|:....|:::..|..||::|:.| ::|.::|.:.:.:.||...:
 Frog   202 YTYACELSKTMYELACEVLTANQMDGQIKLLHMKSHDIQIPEHIPERVSLVVTETVDAGLFGEGI 266

  Fly   155 LESLLFA----------RDKWLSATGHIYPDTAQLYLAAIKGRDQDLGFWHDVHGFDLSAIRRRC 209
            :|||:.|          :|..:...|.:.|.:|.:|..|::  ..::...:.|...:::.||...
 Frog   267 VESLIHAWKNLLLPPKPKDGRVKGYGQVIPSSAVIYGMAVE--CPEIRRHYSVSVSEVAGIRLGE 329

  Fly   210 ESK------------AVVEHVTGDQM---------MSRVCLVKSLDLYT----EPRQSAKSRSLF 249
            |.|            .|.|..|.::|         :|:...|.::|..:    |...|..|:.: 
 Frog   330 EVKFCSALHCSHGPDDVTEPYTTEKMSRVPGGYKALSQPFQVMTVDFNSLQALEYIASGTSKRI- 393

  Fly   250 ELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLETPLP-----VRAGECI 309
            .:.|.:.|.....:|:|   ..:.....|.||.||.. |.|.|.||.:: .||     |..|:.|
 Frog   394 SVPVYQQGQFDCFIAWF---LLQLDDEHSLSTGPSEE-TCWEQAVFPVQ-KLPDESCYVNTGDTI 453

  Fly   310  309
             Frog   454  453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 30/81 (37%)
prmt9XP_012813001.1 TPR 13..>185 CDD:223533 16/47 (34%)
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
AdoMet_MTases 148..>333 CDD:388410 57/187 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.