DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and carm1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002942887.1 Gene:carm1 / 100170180 XenbaseID:XB-GENE-484572 Length:602 Species:Xenopus tropicalis


Alignment Length:347 Identity:121/347 - (34%)
Similarity:183/347 - (52%) Gaps:29/347 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GNHTDANQIIKDRRRQEE----HYFKLYGRIEIHEWLLKDSVRIKAYREAI-QHNEFFRHKTVLD 73
            |..|.|::......|.||    .||:.||.:...:.:::|.||...|:.|| |::..|:.|.|||
 Frog    97 GCRTPASEKSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKVVLD 161

  Fly    74 VGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVD 138
            ||||.|:||.||.:||:::|.||||:|:::.|:.:|:.|.....|.||.||||:..||:   :||
 Frog   162 VGCGSGILSFFAVQAGARKVYAVEASTMAQHAELLVKSNNLTDRIVVIPGKVEETALPE---QVD 223

  Fly   139 IIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGRDQDL--------GFWH 195
            ||:.:.||..||:..||||.|.|: |:|...|:::|....::||..  .|:.|        .||:
 Frog   224 IIISEPMGYMLFNERMLESYLHAK-KFLKPNGNMFPTIGDVHLAPF--TDEQLYMEQFTKANFWY 285

  Fly   196 --DVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSL------FELK 252
              ..||.||||:|.....:...:.|. |....|:.:.||:. ||.....||...|      |...
 Frog   286 QPSFHGVDLSALRGAAVDEYFKQPVV-DTFDIRILMAKSVK-YTVNFLDAKEADLHRIEIPFSFH 348

  Fly   253 VSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKP 317
            :..:|.||||..:|||.|..|...:..||:|:.|.|||.|....|::||..:||:.:.|...:..
 Frog   349 MLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLLQSPLFTKAGDTLTGTALLIA 413

  Fly   318 SEDSIFDTEFDIFVNFDGREKS 339
            ::...:|......|:..|.:.|
 Frog   414 NKRQSYDISIVAQVDQTGSKSS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 38/79 (48%)
carm1XP_002942887.1 CARM1 9..109 CDD:371585 3/11 (27%)
Methyltransf_25 159..254 CDD:379312 48/98 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.