DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt6

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001120104.1 Gene:prmt6 / 100145123 XenbaseID:XB-GENE-5857258 Length:340 Species:Xenopus tropicalis


Alignment Length:307 Identity:106/307 - (34%)
Similarity:170/307 - (55%) Gaps:16/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTVLDVGCGMGVLSMFAAKA 88
            :|..|:..||:.|..:.:||.::.|:||..||:.|:..| ...:.|||||||.|.|:||:|:.:|
 Frog    10 ERTEQDCEYFQCYSDVSVHEEMIADTVRTNAYKLALLRNHSSLQGKTVLDVGAGTGILSVFSVQA 74

  Fly    89 GSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGN 153
            |::.|.||||:::|:.|.|||:.|:....::|:...||..|:|:   :||.||.:|||..|...:
 Frog    75 GAQAVYAVEASSMSQLACQVVKSNDMENKVKVLNSSVESAEIPE---QVDAIVSEWMGYALMYES 136

  Fly   154 MLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR--DQDLGFWHDV---HGFDLSAIR---RRC- 209
            ||.|:::||||||...|.|.|..|.|::|.:...  :..|.||.:|   :|.|:|.::   |.| 
 Frog   137 MLPSVIYARDKWLKPGGLILPSCADLFIAPVNDLIVESRLDFWSEVKGMYGVDMSCMQSFARSCI 201

  Fly   210 -ESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKS-RSLFELKVSRNGWVHGLVAYFDVGFSK 272
             ..:..|..|:.:.::|......||||....::..:: ...|:.....:..:||...:|.|.| .
 Frog   202 MNKEMAVNLVSPEDVLSFPVRFASLDLNVCTQEEVRNLHGSFQFSCFGSSLLHGFAVWFSVTF-P 265

  Fly   273 STQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSE 319
            ....::.||||....|||.||:.||:..:.|.....|.|.:|:.||:
 Frog   266 GENSVTLSTSPYGEETHWKQTLLYLDEEVQVEQDTEITGDVTLSPSD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 36/79 (46%)
prmt6NP_001120104.1 AdoMet_MTases 56..156 CDD:100107 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.