DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL40 and Kxd1

DIOPT Version :10

Sequence 1:NP_476776.1 Gene:RpL40 / 33629 FlyBaseID:FBgn0003941 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_083642.1 Gene:Kxd1 / 75620 MGIID:1922870 Length:177 Species:Mus musculus


Alignment Length:46 Identity:13/46 - (28%)
Similarity:20/46 - (43%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKTLTGKTITLEVEPSDTI-ENVKAKIQDKEGIPPDQQRLIFAGKQ 49
            ::||.||......|....| |....:.:|::.|||.....|...:|
Mouse    84 IRTLKGKLARQHPEAFSHIPEGSFLEDEDEDPIPPSITTTIATSEQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL40NP_476776.1 Ubl_ubiquitin 1..76 CDD:340501 13/46 (28%)
Ribosomal_L40e 79..126 CDD:395807
Kxd1NP_083642.1 KxDL 14..93 CDD:463018 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..177 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.