DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL40 and Ubc

DIOPT Version :10

Sequence 1:NP_476776.1 Gene:RpL40 / 33629 FlyBaseID:FBgn0003941 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_062613.3 Gene:Ubc / 22190 MGIID:98889 Length:734 Species:Mus musculus


Alignment Length:36 Identity:10/36 - (27%)
Similarity:18/36 - (50%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VADLAPMLWHSFGTTAAL--LQEIIHIYPSINPATL 80
            :|:..|:...|||.:..|  |.:.:|....|:.:.|
Mouse     1 MAEAVPVQRDSFGCSLQLAPLLQALHCSCQISSSIL 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL40NP_476776.1 Ubl_ubiquitin 1..76 CDD:340501 8/30 (27%)
Ribosomal_L40e 79..126 CDD:395807 1/2 (50%)
UbcNP_062613.3 Ubl_ubiquitin 1..76 CDD:340501 10/36 (28%)
Ubl_ubiquitin 77..152 CDD:340501
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
Ubl_ubiquitin 533..608 CDD:340501
Ubl_ubiquitin 609..684 CDD:340501
Ubl1_cv_Nsp3_N-like 685..>713 CDD:475130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.