DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL40 and Uba52

DIOPT Version :10

Sequence 1:NP_476776.1 Gene:RpL40 / 33629 FlyBaseID:FBgn0003941 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_063936.1 Gene:Uba52 / 22186 MGIID:98887 Length:128 Species:Mus musculus


Alignment Length:107 Identity:22/107 - (20%)
Similarity:38/107 - (35%) Gaps:34/107 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQAGNLPPMASNSEK-----VFQWINELSNPESRETALLELSK----KRESVADLAP-----MLW 55
            ||:|..|.:...|.|     |.:|:.:..:.:..|....|..|    .|:.:|.||.     ::.
Mouse   896 QQSGGKPGVTFTSAKGEVFSVLEWVPDTHSFKKMEFQPAEAKKFFSTVRKEMALLATSLPDGIMV 960

  Fly    56 HSFGTTAALLQEII--------------------HIYPSINP 77
            .:|.....|...:|                    :|||::.|
Mouse   961 KTFEDRMDLFSALIKGPHRTPYEDGLFLFDIQLPNIYPAVPP 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL40NP_476776.1 Ubl_ubiquitin 1..76 CDD:340501 21/104 (20%)
Ribosomal_L40e 79..126 CDD:395807
Uba52NP_063936.1 Ubl_ubiquitin 1..76 CDD:340501
Ribosomal_L40e 79..126 CDD:395807
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.