DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL40 and F52C6.2

DIOPT Version :10

Sequence 1:NP_476776.1 Gene:RpL40 / 33629 FlyBaseID:FBgn0003941 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_494128.3 Gene:F52C6.2 / 173558 WormBaseID:WBGene00018659 Length:228 Species:Caenorhabditis elegans


Alignment Length:69 Identity:32/69 - (46%)
Similarity:50/69 - (72%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKTLT-GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST 66
            :|||..| |||..:.::.:|||..:|.|:|:||||||:||||:|.|.:|.|.||::...:::.::
 Worm   156 VFVKNSTGGKTTAVSIKNTDTIGTLKLKVQEKEGIPPNQQRLLFKGSELMDYRTVAHCGLRQGTS 220

  Fly    67 LHLV 70
            |.||
 Worm   221 LDLV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL40NP_476776.1 Ubl_ubiquitin 1..76 CDD:340501 32/69 (46%)
Ribosomal_L40e 79..126 CDD:395807
F52C6.2NP_494128.3 ubiquitin 156..224 CDD:459726 30/67 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.