DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL40 and K10C2.12

DIOPT Version :10

Sequence 1:NP_476776.1 Gene:RpL40 / 33629 FlyBaseID:FBgn0003941 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001257042.1 Gene:K10C2.12 / 13221052 WormBaseID:WBGene00206386 Length:88 Species:Caenorhabditis elegans


Alignment Length:68 Identity:20/68 - (29%)
Similarity:36/68 - (52%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKT--LTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 65
            ::.||  ..|.||.|.:..:.|:...|:||::...:|...|.::|....|||.:.|.:|.|:...
 Worm     7 VYNKTRKYAGHTIDLNLGDNATVAEAKSKIEEMTTVPSQIQWIVFGTTHLEDSKPLREYGIRDGY 71

  Fly    66 TLH 68
            |::
 Worm    72 TIY 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL40NP_476776.1 Ubl_ubiquitin 1..76 CDD:340501 20/68 (29%)
Ribosomal_L40e 79..126 CDD:395807
K10C2.12NP_001257042.1 Ubl_ubiquitin_like 16..74 CDD:340559 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.