DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ft and Cdhr4

DIOPT Version :9

Sequence 1:NP_477497.1 Gene:ft / 33627 FlyBaseID:FBgn0001075 Length:5147 Species:Drosophila melanogaster
Sequence 2:NP_001365320.1 Gene:Cdhr4 / 69398 MGIID:1916648 Length:783 Species:Mus musculus


Alignment Length:736 Identity:157/736 - (21%)
Similarity:260/736 - (35%) Gaps:166/736 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 YRLESGGEGL----FQLDARS-----GAISLRGDAPASMHWKPH-------YKLLVSARDAGQRR 802
            |..|:.|.|.    |..:..|     ..:|:|  .|.|...||.       |.::||...:    
Mouse    26 YISENNGPGTVLRPFSFNCSSYMPTLELLSVR--PPTSFFNKPSMHGDKGVYLVMVSLSSS---- 84

  Fly   803 SQQDAIVEIVLKSKLEM-LECGQAQAGGYEFQMVEDHEQQRNSQPNREVG--------IVQVKST 858
            ::.||:.  |.:.:|:: ..||.....|..|..|     ||:....|..|        .:.|..|
Mouse    85 ARLDALA--VNQYELQLQYRCGNFVVDGSIFVHV-----QRDPGRIRCTGAFASPAGEFIYVPET 142

  Fly   859 ------------NGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSS 911
                        .|...:.|.....|......|.||.:......::.|..:.|..::|.|..|..
Mouse   143 ITPGALVYTLLLPGVQRAQINITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKTFQLQISVSFE 207

  Fly   912 SSSS-----------AAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIY 965
            .:.|           |.:|.||:.|                      ...:|::.|:...|.|: 
Mouse   208 KNQSCRGMLTVKVLPAPSSQVSFLQ----------------------KAQSITISEDLVPGSEV- 249

  Fly   966 LSRVRDRDAGVNSRISYSLTN-NPNQQFRIGPVTGVLYLQRPI---RAEPGSLIHVELMATDAGS 1026
               ||.:..|.|  :.|.:.: .|:..:.||...||:....|:   |.:...:..:::.|.:...
Mouse   250 ---VRVQATGFN--LLYEIISPRPSLFYSIGQADGVVRTTAPLDLARVQGAMVTKLQVRAFERPR 309

  Fly  1027 PPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGR-ISYEIIE 1090
            |..|:...|:|.:..||...|........|.:|||:.|.|...||...|.|  ..|| :.|::  
Mouse   310 PWASAVFDLTVSVRAVNQWPPRCHPALLVTQIPETSLVGTVLDALTCVDPD--SAGRPLDYQL-- 370

  Fly  1091 GNTERMFGVFPDG--------YLFVRAPLDREERD---YYALTVSCRDAGQPSRSSVVPVVIHVI 1144
                 .|...||.        .|.|.|.||.:...   .::.::...|.|||..::.:||::.|.
Mouse   371 -----RFHSPPDSASLRLRDRILEVNATLDCDTPGACFQHSASILVVDGGQPQMTTEIPVLVMVT 430

  Fly  1145 DENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIK 1209
            ..|:.:|.....  ||.:.|:....|.:|.:...|.|..||: |.:.:|.....|.:|..:|.:.
Mouse   431 PVNEFSPACVPR--TFRVQEDTGPHTLLGSIVGTDMDYPRNS-LEYYISGGPSTFAVDRLSGELH 492

  Fly  1210 TLRPFD--REALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVN 1272
            .|.|.|  ::.|.|::.......:|..|....:|:                   ..:.:.|.|||
Mouse   493 LLGPLDYEQQRLYKITILLIDHSQDWDLNSHRSGS-------------------CTITIEVEDVN 538

  Fly  1273 DNAPEFLRAPY-HVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLS 1336
            |:||| ...|: .:||.........:|.|......|.....:.||:..||...:|.|..|     
Mouse   539 DHAPE-CEPPFQELTIYTPMGHSMEVTKVSCWIPQEPQRLTLSYSIVGGNSQSRFRLQGA----- 597

  Fly  1337 LGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGT 1401
                           |:|..|..|..|.........:::...|..|.....|:..:::      .
Mouse   598 ---------------ILVYNDTVLGPPWPEQPCTYELLIHVADVGPSIPHLSTTTTII------V 641

  Fly  1402 ELMRFRASDADQGVNSQVVFS 1422
            .|:.::||......:...|.|
Mouse   642 HLVPWKASTVATSTHQSTVSS 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftNP_477497.1 Cadherin_repeat 71..152 CDD:206637
Cadherin_repeat 163..266 CDD:206637
Cadherin_repeat 275..378 CDD:206637
Cadherin_repeat 393..490 CDD:206637
Cadherin_repeat 498..594 CDD:206637
Cadherin_repeat 603..704 CDD:206637
Cadherin_repeat 735..814 CDD:206637 18/75 (24%)
Cadherin 843..>907 CDD:278457 13/83 (16%)
Cadherin 950..1026 CDD:278457 17/79 (22%)
Cadherin_repeat 1053..1149 CDD:206637 29/107 (27%)
Cadherin_repeat 1157..1274 CDD:206637 26/118 (22%)
Cadherin_repeat 1282..1380 CDD:206637 18/98 (18%)
Cadherin_repeat 1390..1485 CDD:206637 5/33 (15%)
Cadherin_repeat 1497..1597 CDD:206637
Cadherin_repeat 1621..1699 CDD:206637
Cadherin_repeat 1720..1818 CDD:206637
Cadherin_repeat 1827..1918 CDD:206637
Cadherin_repeat 1926..2023 CDD:206637
Cadherin_repeat 2031..2162 CDD:206637
Cadherin_repeat 2172..2274 CDD:206637
Cadherin_repeat 2282..2380 CDD:206637
Cadherin_repeat 2388..2487 CDD:206637
Cadherin_repeat 2495..2592 CDD:206637
Cadherin_repeat 2600..2694 CDD:206637
Cadherin_repeat 2710..2806 CDD:206637
Cadherin_repeat 2814..2909 CDD:206637
Cadherin_repeat 2917..3009 CDD:206637
Cadherin 3018..3114 CDD:278457
Cadherin 3129..3220 CDD:278457
Cadherin_repeat 3233..3330 CDD:206637
Cadherin_repeat 3338..3434 CDD:206637
Cadherin_repeat 3443..3541 CDD:206637
Cadherin_repeat 3550..3647 CDD:206637
Cadherin_repeat 3657..3753 CDD:206637
EGF 4017..4047 CDD:278437
EGF_CA 4056..4090 CDD:238011
EGF_CA 4094..4128 CDD:238011
Laminin_G_1 4156..4306 CDD:278483
LamG 4428..4543 CDD:238058
Cdhr4NP_001365320.1 Cadherin_repeat 236..326 CDD:206637 21/95 (22%)
Cadherin_repeat 338..434 CDD:206637 28/104 (27%)
Cadherin_repeat 441..540 CDD:206637 26/120 (22%)
Cadherin_repeat 555..644 CDD:206637 18/114 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.