DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ft and CDHR4

DIOPT Version :9

Sequence 1:NP_477497.1 Gene:ft / 33627 FlyBaseID:FBgn0001075 Length:5147 Species:Drosophila melanogaster
Sequence 2:XP_016861855.1 Gene:CDHR4 / 389118 HGNCID:34527 Length:841 Species:Homo sapiens


Alignment Length:787 Identity:175/787 - (22%)
Similarity:274/787 - (34%) Gaps:230/787 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 PASMHWKPHY--KLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECG-QAQAGGYEFQMVED--HE 839
            |:...|:..|  ||.:|:      .:|.||::....|.:|: ..|| ....|.....:..|  |.
Human   120 PSLARWQGTYVGKLTLSS------SAQLDALMVNHYKVQLK-FTCGNHVMEGSLSVDVQRDLSHI 177

  Fly   840 QQRNSQPNREVGIVQVKST------------NGKANSHIEYDIIQGDRAQN-------FRIDTRS 885
            |......:....::||..|            .|......:..||.   ||:       |.|:.:.
Human   178 QCAGQFASPAGEMIQVPETVTPGARLYTLLLPGLELHGAQMSIIS---AQDLPHFPGPFSINEQG 239

  Fly   886 GRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQ---C--IVNIAIIDLNDNAPVFALD 945
            .....::.|..:.|..::|.|             |||:||   |  :|.:.::.:..:...|.  
Human   240 WLQAPSQGLLGQAQKVFQLQI-------------SVSFGQRQSCQGMVIVKVLPVPSSQVSFL-- 289

  Fly   946 RESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPI--- 1007
             |....|::|||.|.|.|:...:.|    ||:.|... |:..|:..|.||...||:....|:   
Human   290 -EQAQNITIPENLAPGSEVVQVQAR----GVDLRYEI-LSPVPSPLFSIGRADGVVRTTTPLELA 348

  Fly  1008 RAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALA 1072
            |....::..:::.|.:.|....|:||:|::.:..||...|        ..||             
Human   349 RTSGTAVSRLQVKAFEQGQLWASAKLNLTMNVQLVNLWPP--------RCLP------------- 392

  Fly  1073 ATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVV 1137
                                                           ||.||             
Human   393 -----------------------------------------------ALLVS------------- 397

  Fly  1138 PVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD-IGRNAELSFTLSSQTQDFTI 1201
                                   .|||.||..|.:..||..|.| :|.               |:
Human   398 -----------------------QIPETAPVGTVLNTLTCEDPDSVGA---------------TL 424

  Fly  1202 DTRNGFIKTLRP-----FDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDK 1261
            |.:..|..:..|     :||...|..:.:.:..|.......|:         .|.|.|.|::..:
Human   425 DYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASI---------LVLDGGQPQMTTE 480

  Fly  1262 VKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQF 1326
            |.|.|:||.:|:.:|..  ||....:.|.|:..|.:..|...|.|...:...||:  .|... .|
Human   481 VPVLVMVTPINEFSPAC--APRTFRVQEDAAPHTLLGSVVGTDMDYPHDNIEYYT--SGGPT-TF 540

  Fly  1327 NLDSATGQLSLGRRLDRESQEIHHLIVV----AKDAALKHPLSSNASITIVVLDENDNAPEFTQS 1387
            .:|..:|::.|...||.|.|.::.|.|:    .:|....|.||.:.:|||.|.|.||:|||....
Human   541 AVDRLSGEVHLLGPLDYEQQRLYRLTVLVIDHGQDQNPNHHLSGSCTITIEVEDVNDHAPECEPP 605

  Fly  1388 SSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTF--------HIDSITGSLYLH 1444
            ..|:::........|:.:.......:.......:||..||.::.|        |.|.:.|..:..
Human   606 FQELTIYAPLGRSVEVTKMSCQIPQEPQRLIYSYSIVGGNSQNRFILQGAILVHSDLVLGPFWPE 670

  Fly  1445 KPLDYEDITSYTLNITASDCG--TPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIP-LKT 1506
            :|..||      |.|..:|.|  ||.||||....|.:|      |...||......:..:| ..|
Human   671 QPRTYE------LLICVADAGPSTPHLSTTATIIVHLV------PRRASTVATSTHRTTVPSTMT 723

  Fly  1507 P-IVTVT 1512
            | :||.|
Human   724 PMLVTDT 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftNP_477497.1 Cadherin_repeat 71..152 CDD:206637
Cadherin_repeat 163..266 CDD:206637
Cadherin_repeat 275..378 CDD:206637
Cadherin_repeat 393..490 CDD:206637
Cadherin_repeat 498..594 CDD:206637
Cadherin_repeat 603..704 CDD:206637
Cadherin_repeat 735..814 CDD:206637 9/35 (26%)
Cadherin 843..>907 CDD:278457 13/82 (16%)
Cadherin 950..1026 CDD:278457 21/78 (27%)
Cadherin_repeat 1053..1149 CDD:206637 6/95 (6%)
Cadherin_repeat 1157..1274 CDD:206637 30/122 (25%)
Cadherin_repeat 1282..1380 CDD:206637 30/101 (30%)
Cadherin_repeat 1390..1485 CDD:206637 25/104 (24%)
Cadherin_repeat 1497..1597 CDD:206637 6/18 (33%)
Cadherin_repeat 1621..1699 CDD:206637
Cadherin_repeat 1720..1818 CDD:206637
Cadherin_repeat 1827..1918 CDD:206637
Cadherin_repeat 1926..2023 CDD:206637
Cadherin_repeat 2031..2162 CDD:206637
Cadherin_repeat 2172..2274 CDD:206637
Cadherin_repeat 2282..2380 CDD:206637
Cadherin_repeat 2388..2487 CDD:206637
Cadherin_repeat 2495..2592 CDD:206637
Cadherin_repeat 2600..2694 CDD:206637
Cadherin_repeat 2710..2806 CDD:206637
Cadherin_repeat 2814..2909 CDD:206637
Cadherin_repeat 2917..3009 CDD:206637
Cadherin 3018..3114 CDD:278457
Cadherin 3129..3220 CDD:278457
Cadherin_repeat 3233..3330 CDD:206637
Cadherin_repeat 3338..3434 CDD:206637
Cadherin_repeat 3443..3541 CDD:206637
Cadherin_repeat 3550..3647 CDD:206637
Cadherin_repeat 3657..3753 CDD:206637
EGF 4017..4047 CDD:278437
EGF_CA 4056..4090 CDD:238011
EGF_CA 4094..4128 CDD:238011
Laminin_G_1 4156..4306 CDD:278483
LamG 4428..4543 CDD:238058
CDHR4XP_016861855.1 Cadherin_repeat 294..384 CDD:206637 26/94 (28%)
Cadherin_repeat 398..492 CDD:206637 29/117 (25%)
Cadherin_repeat 499..598 CDD:206637 30/101 (30%)
Cadherin_repeat <638..702 CDD:206637 22/69 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.