DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ft and CDHR3

DIOPT Version :9

Sequence 1:NP_477497.1 Gene:ft / 33627 FlyBaseID:FBgn0001075 Length:5147 Species:Drosophila melanogaster
Sequence 2:NP_689963.2 Gene:CDHR3 / 222256 HGNCID:26308 Length:885 Species:Homo sapiens


Alignment Length:706 Identity:188/706 - (26%)
Similarity:299/706 - (42%) Gaps:144/706 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1523 KVSYAISKQEPQLPQ-----------------GRHFGINTETGVIHTLREIDRES-IDTFRLTVV 1569
            |:|.::|...|..||                 |.:|.:.| ||    :.::|.|: .:.|.|.:.
Human    47 KLSASLSPVIPGFPQIVNSNPLTEAFRVNWLSGTYFEVVT-TG----MEQLDFETGPNIFDLQIY 106

  Fly  1570 ATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFS-----------TSKGSSTAV 1623
            ..|....::.|     ::||.|.|:|:             ||:|.           ..:.:...:
Human   107 VKDEVGVTDLQ-----VLTVQVTDVNE
-------------PPQFQGNLAEGLHLYIVERANPGFI 153

  Fly  1624 MQVHAKD-ADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVR-YQLTLKSTDEAVQ 1686
            .||.|.| .|:|.|..::|.::|.|:. |::..| |.:..|....|:...| :.|.::..|..  
Human   154 YQVEAFDPEDTSRNIPLSYFLISPPKS-FRMSAN-GTLFSTTELDFEAGHRSFHLIVEVRDSG-- 214

  Fly  1687 SERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAE-----IE 1746
            ..:.|:|:.:.|:     .....||:|...:::...:.|..| ||.:..:||.....|     :.
Human   215 GLKASTELQVNIV-----NLND
EVPRFTSPTRVYTVLEELSP-GTIVANITAEDPDDEGFPSHLL 273

  Fly  1747 YFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAG-----PE-EYEVEVYAIALGGQPRTS 1805
            |.:|.|:         :.|.|:...|.:..|..:||:||     |. ..||.|.....|||  .:
Human   274 YSITTVS---------KYFMINQLTGTIQVAQRIDRDAGELRQNPTISLEVLVKDRPYGGQ--EN 327

  Fly  1806 RTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLR-------AHDPDTLGSVTFLLMDG 1863
            |.::...|.|.||:|.......|...|.|....|..:..|.       :..|:...:.|.....|
Human   328 RIQITFIVEDVNDN
PATCQKFTFSIMVPERTAKGTLLLDLNKFCFDDDSEAPNNRFNFTMPSGVG 392

  Fly  1864 HDGKFLLEPS-TGKLILNDTLDRETKS------KYELRIRVSD-GVQY--TEAYATIQVSDTNDN 1918
            ...:||.:|: :||::|...||.|..|      ||.:.|:|.| ...|  ...|..|..|..|:.
Human   393 SGSRFLQDPAGSGKIVLIGDLDYENPSNLAAGNKYTVIIQVQDVAPPYYKNNVYVYILTSPENEF 457

  Fly  1919 PPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAN----DVFSLNPQTGML 1979
            |.:|:...|.||:.|......:|||:.|.|.||.|:: |.|.:.:..|:    :||.:||:||.|
Human   458 PLIFDRPSYVFDVSERRPARTRVGQVRATDKDLPQSS-LLYSISTGGASLQYPNVFWINPKTGEL 521

  Fly  1980 TLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIAT 2044
            .|..::|.|....|||.:||.:|...| |.|:||  |:|:.||..||..|.||    |..:|:..
Human   522 QLVTKVDCETTPIYILRIQATNNEDTS-SVTVTV--NILEENDEKPICTPNSY----FLALPVDL 579

  Fly  2045 EVVT------VSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVT 2102
            :|.|      ::..|:||.... ..|||..|:|::.|....| |:..||            |.:|
Human   580 KVGTNIQNFKLTCTDLDSSPRS-FRYSIGPGNVNNHFTFSPNAGSNVTR------------LLLT 631

  Fly  2103 ARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIK 2158
            :|  .|....|.::.:.:| |.|.:.......|      :|.:.|..|..||:.||
Human   632 SR--FDYAGGFDKIWDYKL-LVYVTDDNLMSDR------KKAEALVETGTVTLSIK 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftNP_477497.1 Cadherin_repeat 71..152 CDD:206637
Cadherin_repeat 163..266 CDD:206637
Cadherin_repeat 275..378 CDD:206637
Cadherin_repeat 393..490 CDD:206637
Cadherin_repeat 498..594 CDD:206637
Cadherin_repeat 603..704 CDD:206637
Cadherin_repeat 735..814 CDD:206637
Cadherin 843..>907 CDD:278457
Cadherin 950..1026 CDD:278457
Cadherin_repeat 1053..1149 CDD:206637
Cadherin_repeat 1157..1274 CDD:206637
Cadherin_repeat 1282..1380 CDD:206637
Cadherin_repeat 1390..1485 CDD:206637
Cadherin_repeat 1497..1597 CDD:206637 22/91 (24%)
Cadherin_repeat 1621..1699 CDD:206637 20/79 (25%)
Cadherin_repeat 1720..1818 CDD:206637 28/108 (26%)
Cadherin_repeat 1827..1918 CDD:206637 28/107 (26%)
Cadherin_repeat 1926..2023 CDD:206637 39/100 (39%)
Cadherin_repeat 2031..2162 CDD:206637 35/135 (26%)
Cadherin_repeat 2172..2274 CDD:206637
Cadherin_repeat 2282..2380 CDD:206637
Cadherin_repeat 2388..2487 CDD:206637
Cadherin_repeat 2495..2592 CDD:206637
Cadherin_repeat 2600..2694 CDD:206637
Cadherin_repeat 2710..2806 CDD:206637
Cadherin_repeat 2814..2909 CDD:206637
Cadherin_repeat 2917..3009 CDD:206637
Cadherin 3018..3114 CDD:278457
Cadherin 3129..3220 CDD:278457
Cadherin_repeat 3233..3330 CDD:206637
Cadherin_repeat 3338..3434 CDD:206637
Cadherin_repeat 3443..3541 CDD:206637
Cadherin_repeat 3550..3647 CDD:206637
Cadherin_repeat 3657..3753 CDD:206637
EGF 4017..4047 CDD:278437
EGF_CA 4056..4090 CDD:238011
EGF_CA 4094..4128 CDD:238011
Laminin_G_1 4156..4306 CDD:278483
LamG 4428..4543 CDD:238058
CDHR3NP_689963.2 Cadherin_repeat 26..128 CDD:206637 21/90 (23%)
Cadherin_repeat 141..231 CDD:206637 21/98 (21%)
Cadherin_repeat 242..341 CDD:206637 29/110 (26%)
Cadherin_repeat 349..456 CDD:206637 27/106 (25%)
Cadherin_repeat 465..561 CDD:206637 38/99 (38%)
Cadherin_repeat 570..679 CDD:206637 35/135 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 808..885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.