DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ft and Cdhr1

DIOPT Version :9

Sequence 1:NP_477497.1 Gene:ft / 33627 FlyBaseID:FBgn0001075 Length:5147 Species:Drosophila melanogaster
Sequence 2:NP_570948.1 Gene:Cdhr1 / 170677 MGIID:2157782 Length:859 Species:Mus musculus


Alignment Length:755 Identity:202/755 - (26%)
Similarity:318/755 - (42%) Gaps:149/755 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1795 AIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPF--------VYNVSEDLQIGHTISTLRAHDPD 1851
            |:.||        .:|:.:...|.: |.|.|...        ::::.||..:|..:.||...||:
Mouse     8 ALVLG--------LLRIYLAQANFA-PHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGTDPE 63

  Fly  1852 ------------TLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYT 1904
                        :..||           |.::|:.|.:.|.:.||||.:.:.|..|.:|||:...
Mouse    64 GDPISYHISFDPSTRSV-----------FSVDPNFGNITLVEELDREREDEIEAIISISDGLNLV 117

  Fly  1905 EAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDV 1969
            .....|.|:|.||..|.|....|...:|||...|..:.::.|.|.|.|....::|. :.:..:..
Mouse   118 AEKVVILVTDANDEAPRFIQEPYIIRVPENIPAGSSIFKVQAEDKDTGSGGSVTYS-LQNLHSSK 181

  Fly  1970 FSLNPQTGMLTLT--ARLDYEEVQ-HYILIVQAQDNG------QPSLSTTITVYCNVLDLNDNAP 2025
            ||::..:|:|.|.  |.||||:.: |||.:: |:|.|      ....|.|.||..||.|:.|.||
Mouse   182 FSMDRHSGVLRLQAGATLDYEKSRAHYITVI-AKDGGGRLRGADMVFSATTTVTINVEDVQDTAP 245

  Fly  2026 IFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGI-DSNGTIRTRRNL 2089
            ||....|...|:|:....:||:||.|.|.|.|....|.|.: ..:.|..|.| :::|.|...::.
Mouse   246 IFVGTPYYGYVYEDTLPGSEVLTVVAIDGDRGKPNHILYRL-LNESDGIFEINETSGAISVLQSP 309

  Fly  2090 DREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVT 2154
            ....|..|.|.|...:                   ..||              ......:||.||
Mouse   310 ALLRREVYELHVQVTE-------------------VNSP--------------GSPAAQATVPVT 341

  Fly  2155 ILIKDVNDEVPVFISAN------ETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDM 2213
            |.|.|:|:..|.|...:      |.::.|:.....::..:|...|                |.|.
Mouse   342 IRIVDLNNHPPTFYGESGPQNKFELSMFEHPPQGEILRGLKITVN----------------DSDQ 390

  Fly  2214 GQSDPLPFSLNPTDGQLRVVD-----------------ALDRELRSSYLLNITARDRGEPPQ-ST 2260
            |.:......|....|..|||.                 |:|.|........:.|.:...|.: |:
Mouse   391 GANAKFNLRLVGPGGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKLLTFKLLAIEVNTPEKFSS 455

  Fly  2261 ESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD 2325
            .:.::|::||.|||.|.|....|.|.:.|||..|:.|:.|:|.|.|.|..|::.||| .|..:..
Mouse   456 TADIVIQLLDTNDNVPKFTSHYYIARIPENAPGGSNVVAVTAVDPDTGPWGKVHYSI-YGTGSDL 519

  Fly  2326 FSISEDTGVVRVA--KNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSP 2388
            |.|...||::...  .:|:.|..|||:..|:|||.   :.....||:.:.:||:||:.|.|:.| 
Mouse   520 FLIHPSTGLIYTQPWASLDAEGTSRYNFYVKAEDM---DGRYSLAEVFVTLLDVNDHYPQFVQS- 580

  Fly  2389 YLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS-DLFRINASSGDIAL------L 2446
                |.|.|:..  |..|.:.|.|.|....|:.|.|.:...:. ::|.|:|.:|:|.|      |
Mouse   581 ----VQEKTMVL--GTPLKIEATDQDAEEPNNLVDYSITRAEPVNVFDIDAHTGEIRLKNSIRSL 639

  Fly  2447 KPLDREQQS---EYTLTLVAMDTGSPPLTGTGIVRVEVQD 2483
            :.|.....|   .::|.:.|.|.|||..:.|.::::::.|
Mouse   640 EALHNITPSGDYSWSLQVQAKDRGSPSFSTTALLKIDITD 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftNP_477497.1 Cadherin_repeat 71..152 CDD:206637
Cadherin_repeat 163..266 CDD:206637
Cadherin_repeat 275..378 CDD:206637
Cadherin_repeat 393..490 CDD:206637
Cadherin_repeat 498..594 CDD:206637
Cadherin_repeat 603..704 CDD:206637
Cadherin_repeat 735..814 CDD:206637
Cadherin 843..>907 CDD:278457
Cadherin 950..1026 CDD:278457
Cadherin_repeat 1053..1149 CDD:206637
Cadherin_repeat 1157..1274 CDD:206637
Cadherin_repeat 1282..1380 CDD:206637
Cadherin_repeat 1390..1485 CDD:206637
Cadherin_repeat 1497..1597 CDD:206637
Cadherin_repeat 1621..1699 CDD:206637
Cadherin_repeat 1720..1818 CDD:206637 4/22 (18%)
Cadherin_repeat 1827..1918 CDD:206637 26/110 (24%)
Cadherin_repeat 1926..2023 CDD:206637 33/105 (31%)
Cadherin_repeat 2031..2162 CDD:206637 31/131 (24%)
Cadherin_repeat 2172..2274 CDD:206637 22/119 (18%)
Cadherin_repeat 2282..2380 CDD:206637 35/99 (35%)
Cadherin_repeat 2388..2487 CDD:206637 28/106 (26%)
Cadherin_repeat 2495..2592 CDD:206637
Cadherin_repeat 2600..2694 CDD:206637
Cadherin_repeat 2710..2806 CDD:206637
Cadherin_repeat 2814..2909 CDD:206637
Cadherin_repeat 2917..3009 CDD:206637
Cadherin 3018..3114 CDD:278457
Cadherin 3129..3220 CDD:278457
Cadherin_repeat 3233..3330 CDD:206637
Cadherin_repeat 3338..3434 CDD:206637
Cadherin_repeat 3443..3541 CDD:206637
Cadherin_repeat 3550..3647 CDD:206637
Cadherin_repeat 3657..3753 CDD:206637
EGF 4017..4047 CDD:278437
EGF_CA 4056..4090 CDD:238011
EGF_CA 4094..4128 CDD:238011
Laminin_G_1 4156..4306 CDD:278483
LamG 4428..4543 CDD:238058
Cdhr1NP_570948.1 Cadherin_repeat 42..130 CDD:206637 25/98 (26%)
Cadherin_repeat 139..242 CDD:206637 33/104 (32%)
Cadherin_repeat 251..350 CDD:206637 32/132 (24%)
Cadherin_repeat 364..469 CDD:206637 22/120 (18%)
Cadherin_repeat 478..573 CDD:206637 35/98 (36%)
Cadherin_repeat 580..679 CDD:206637 28/105 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 793..838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.