DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naprt and Nampt

DIOPT Version :9

Sequence 1:NP_001097077.1 Gene:Naprt / 33626 FlyBaseID:FBgn0031589 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_038967818.1 Gene:Nampt / 297508 RGDID:631365 Length:500 Species:Rattus norvegicus


Alignment Length:335 Identity:71/335 - (21%)
Similarity:125/335 - (37%) Gaps:107/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YAYW--KSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECL-KFLDSFHYSQSDIEYLKQTLPEGI 100
            |:|:  :..||:::.|..:.:       |.|:|.||:..| |:|.....::..|:..|:...|..
  Rat    43 YSYFECREKKTENSKVRKVKY-------EETVFYGLQYILNKYLKGKVVTKEKIQEAKEVYREHF 100

  Fly   101 EHEFF----------EYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVN 155
            :.:.|          :|.|:|   .:.:.|:.||:| .||..:      |..|:..:.....|.|
  Rat   101 QDDVFNERGWNYILEKYDGHL---PIEVKAVPEGSV-IPRGNV------LFTVENTDPECYWLTN 155

  Fly   156 ----------YASLMATNAARYRMVAGKHV------------KLLEFGLRRAQGPD-GGLSASKY 197
                      |...:|||:...:.:..|::            ||.:||.|.....: .|:.||  
  Rat   156 WIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGAS-- 218

  Fly   198 SYTGGFDGTSNV----LAGKLFNI--PVKG----THAHAYITSFSSIGELKTRLIKHKQTGILED 252
            ::...|.||..|    |..|.:..  ||.|    ...|:.||::....|              :|
  Rat   219 AHLVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHE--------------KD 269

  Fly   253 LLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDTYDVKSRETEQANTEPKH 317
            ..||.|             |:.||..  .::||             |:||:.:...:....:.:|
  Rat   270 AFEHIV-------------TQFSSVP--VSVVS-------------DSYDIYNACEKIWGEDLRH 306

  Fly   318 INDIKSENSP 327
            :...:|..:|
  Rat   307 LIVSRSTEAP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaprtNP_001097077.1 PLN02885 22..667 CDD:178473 71/335 (21%)
NAPRTase_A 27..521 CDD:238804 71/335 (21%)
NamptXP_038967818.1 PBEF_like 28..437 CDD:238803 71/335 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.