DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or94a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:449 Identity:89/449 - (19%)
Similarity:162/449 - (36%) Gaps:127/449 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MERHYFMVPKFAL-----SLIGFYPEQKRTVLVKLWSFFNF------FIL----TYGCYAEAYYG 61
            |::|...:....|     .|.|.:|...::  .:.|:|..|      |:|    |:     .:.|
  Fly     1 MDKHKDRIESMRLILQVMQLFGLWPWSLKS--EEEWTFTGFVKRNYRFLLHLPITF-----TFIG 58

  Fly    62 I----HYIPINIATALDALCPVASSILSLVKMVAIWWYQDELRSLI--------------ERVRF 108
            :    .:|..|:..|...|....:.:..:||:::||.|:.|...|:              |.|.|
  Fly    59 LMWLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYRTEAWRLMYELQHAPDYQLHNQEEVDF 123

  Fly   109 LTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKM 173
            ...:|:.     :|..||      .::|:..|...|....|..|        .|    ||.||..
  Fly   124 WRREQRF-----FKWFFY------IYILISLGVVYSGCTGVLFL--------EG----YELPFAY 165

  Fly   174 MFPDLLLRLPLYPITYILVHW---------HGY----ITVVCF--VGADGFFLGFCLYFTVL--L 221
                           |:...|         :||    :|:.|.  :..|.....|..:.::|  |
  Fly   166 ---------------YVPFEWQNERRYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRL 215

  Fly   222 LCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSS 286
            |.|:     |.|.:|::......::.|.:..|      |..:..||.....::....|:..:.|:
  Fly   216 LGLR-----LRETKNMKNDTIFGQQLRAIFIM------HQRIRSLTLTCQRIVSPYILSQIILSA 269

  Fly   287 LIIGTSVVDILLFSG-----LGI-------IVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARST 339
            |||        .|||     :||       |..:.:...:.::|:|.|..|:.|....:.|....
  Fly   270 LII--------CFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEV 326

  Fly   340 FSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFFSPSLETLTSILRFTGSLIALAKSV 397
            :.::|......::|:....:...::.:||:. .||:..|......:....|.:||..:|
  Fly   327 YHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLNV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 71/363 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 71/363 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.