DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or88a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:430 Identity:93/430 - (21%)
Similarity:141/430 - (32%) Gaps:126/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MVPKFALSLIGFYPEQKRTVLVKLWSFFNFFILTYGCYA----------------------EAYY 60
            ||| |.||                 :|.|  :|.:||..                      ..|:
  Fly    46 MVP-FCLS-----------------AFLN--VLFFGCNGWDIIGHFWLGHPANQNPPVLSITIYF 90

  Fly    61 GIH----YIP----INIATALDALCPVASSILSLVKMVAIWWYQDE-LRSLIERVRFLTEQQKSK 116
            .|.    |:.    :.....||..||  ..::|.:.|     ..|| .|:..:|.||:       
  Fly    91 SIRGLMLYLKRKEIVEFVNDLDRECP--RDLVSQLDM-----QMDETYRNFWQRYRFI------- 141

  Fly   117 RKLGYKKRFYT-------LATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTH-GKDWIYETPFKM 173
                   |.|:       ....|...||                      || |||    ||...
  Fly   142 -------RIYSHLGGPMFCVVPLALFLL----------------------THEGKD----TPVAQ 173

  Fly   174 MFPDLLLRLPL----YPITYILVHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVCDLL-E 233
            ....|...||.    .|..|:|| |.  ..::|......||:.|...|.|:...|...:..|. :
  Fly   174 HEQLLGGWLPCGVRKDPNFYLLV-WS--FDLMCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQ 235

  Fly   234 VENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVM-VEITLAHFVTSS-----LIIGTS 292
            ...|:...|..:|.|...::..||.|...:..|..:.:.:. |...:::||.:.     |.:.:.
  Fly   236 FSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSE 300

  Fly   293 VVDILLFSGLGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLL 357
            ..|:|:     |..|::.|..:....|..||.|:.:.:|...|..|..|..||..|.|.:|..||
  Fly   301 TSDVLI-----IAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLL 360

  Fly   358 MVARAQRVLTI-KIPFFSPSLETLTSILRFTGSLIALAKS 396
            .....||...: .......::...|.|::....|....||
  Fly   361 WTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLKS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 76/340 (22%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 79/371 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.