DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or85d

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:439 Identity:86/439 - (19%)
Similarity:166/439 - (37%) Gaps:114/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EQKRTVLVKLWSFF---NFFILTYG--CYAEAYYG------IHYI----PINIATAL-DALCPV- 79
            ||::...:.|.||.   |.|.|:.|  .|...|..      :|:.    .:|:.|.| ..|..| 
  Fly    12 EQEKLKAIPLHSFLKYANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVLISELIYVF 76

  Fly    80 -----------ASSILSLVKMV-----AIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTL 128
                       |:..||.:..|     .||....:.:.|.:.|..|.|....             
  Fly    77 LAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQ------------- 128

  Fly   129 ATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILV- 192
                       |......|::.|.:....|        |...:..|...|:....||...|.|| 
  Fly   129 -----------GLAQQEPYNIGHHLSGYSR--------YSKFYFGMHMVLIWTYNLYWAVYYLVC 174

  Fly   193 -HWHG------YITVVCFVGADGFFLGFCLYFTVL------LLCLQDD------VCDLLEVENIE 238
             .|.|      .:...|:|..| :..|:..||..:      ..||...      :|.|:.:..:.
  Fly   175 DFWLGMRQFERMLPYYCWVPWD-WSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMH 238

  Fly   239 ----KSPSEAEEARI------VREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLI----- 288
                .:..|:..|.|      :..::..|..|..:..|.:.::.:.....|::||:||.|     
  Fly   239 FIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVG 303

  Fly   289 ----IGTSVVDILLFSGLGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSV 349
                ||:.:.::::     :::::.  ||: |::|:.......:::|...:.::.::..|:...:
  Fly   304 FQMTIGSKIDNLVM-----LVLFLF--CAM-VQVFMIATHAQRLVDASEQIGQAVYNHDWFRADL 360

  Fly   350 RVQKMTLLMVARAQRVLTIKIP-FFSPSLETLTSILRFTGSLIALAKSV 397
            |.:||.:|::.|||:...:|.. |.:.||.|::.:|:.:....||.:::
  Fly   361 RYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 72/377 (19%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 67/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.